ZBTB16 Antibody - C-terminal region (ARP38723_P050)

Data Sheet
 
Product Number ARP38723_P050
Product Page www.avivasysbio.com/zbtb16-antibody-c-terminal-region-arp38723-p050.html
Name ZBTB16 Antibody - C-terminal region (ARP38723_P050)
Protein Size (# AA) 673 amino acids
Molecular Weight 74kDa
NCBI Gene Id 7704
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger and BTB domain containing 16
Alias Symbols PLZF, ZNF145
Peptide Sequence Synthetic peptide located within the following region: GASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPDWRIEKTYLYLCYV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kang,S.I., (2008) Biochem. Biophys. Res. Commun. 369 (4), 1209-1214
Description of Target ZBTB16 is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alternate transcriptional splice variants have been characterized.This gene is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alternate transcriptional splice variants have been characterized.
Protein Interactions KRT40; SH2D4A; TRIM54; LAMTOR5; IL32; ZBTB16; SUMO2; PRKCE; GOLGA2; HDAC1; CEBPA; EP300; MBD3; SIN3A; CBX5; NCOR1; MTA2; HDAC3; TP53; NCOR2; ZNF281; TAB2; SMAD3; CFH; ADAMTS4; HOXA1; CASP3; ATP7B; PARP1; TIMP1; FSHR; EEF1A1; TNK2; ATP6AP2; HDAC4; Gne; Gna
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZBTB16 (ARP38723_P050) antibody
Blocking Peptide For anti-ZBTB16 (ARP38723_P050) antibody is Catalog # AAP38723 (Previous Catalog # AAPP20930)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ZBTB16
Uniprot ID Q05516
Protein Name Zinc finger and BTB domain-containing protein 16
Protein Accession # NP_005997
Purification Affinity Purified
Nucleotide Accession # NM_006006
Tested Species Reactivity Human
Gene Symbol ZBTB16
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human 721_B
WB Suggested Anti-ZBTB16 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysate
Image 2
Human HEK 293T
Lanes:
1. 50 ug untransfected HEK293T lysate
2. 50 ug ZBTB16 transfected HEK293T lysate
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Donkey Anti-rabbit AP
Secondary Antibody Dilution:
1:2000
Gene Name:
ZBTB16
Submitted by:
Anonymous
Image 3
Human HEK 293T
Lanes:
1. 50 ug untransfected HEK293T lysate
2. 50 ug ZBTB16 transfected HEK293T lysate
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Donkey Anti-rabbit AP
Secondary Antibody Dilution:
1:2000
Gene Name:
ZBTB16
Submitted by:
Anonymous
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com