Foxo4 Antibody - C-terminal region (ARP38710_P050)

Data Sheet
 
Product Number ARP38710_P050
Product Page www.avivasysbio.com/foxo4-antibody-c-terminal-region-arp38710-p050.html
Name Foxo4 Antibody - C-terminal region (ARP38710_P050)
Protein Size (# AA) 505 amino acids
Molecular Weight 54kDa
NCBI Gene Id 54601
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Forkhead box O4
Alias Symbols af, Fox, Mll, afx, Afxh, Mllt7
Peptide Sequence Synthetic peptide located within the following region: PPVMAGAPIPKVLGTPVLASPTEDSSHDRMPQDLDLDMYMENLECDMDNI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Foxo4 is a transcription factor involved in the regulation of the insulin signaling pathway. It binds to insulin-response elements (IREs) and can activate transcription of IGFBP1. It down-regulates expression of HIF1A and suppresses hypoxia-induced transcriptional activation of HIF1A-modulated genes. It is also involved in negative regulation of the cell cycle. It represses smooth muscle cell differentiation by inhibiting the transcriptional coactivator activity of myocardin.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Foxo4 (ARP38710_P050) antibody
Blocking Peptide For anti-Foxo4 (ARP38710_P050) antibody is Catalog # AAP38710
Uniprot ID Q99MK2
Protein Name Histone acetyltransferase KAT5
Protein Accession # NP_001005872
Purification Affinity Purified
Nucleotide Accession # NM_001005872
Tested Species Reactivity Mouse
Gene Symbol Foxo4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Mouse Pancreas
WB Suggested Anti-Foxo4 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Pancreas
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com