Product Number |
ARP38710_P050 |
Product Page |
www.avivasysbio.com/foxo4-antibody-c-terminal-region-arp38710-p050.html |
Name |
Foxo4 Antibody - C-terminal region (ARP38710_P050) |
Protein Size (# AA) |
505 amino acids |
Molecular Weight |
54kDa |
NCBI Gene Id |
54601 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Forkhead box O4 |
Alias Symbols |
af, Fox, Mll, afx, Afxh, Mllt7 |
Peptide Sequence |
Synthetic peptide located within the following region: PPVMAGAPIPKVLGTPVLASPTEDSSHDRMPQDLDLDMYMENLECDMDNI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Foxo4 is a transcription factor involved in the regulation of the insulin signaling pathway. It binds to insulin-response elements (IREs) and can activate transcription of IGFBP1. It down-regulates expression of HIF1A and suppresses hypoxia-induced transcriptional activation of HIF1A-modulated genes. It is also involved in negative regulation of the cell cycle. It represses smooth muscle cell differentiation by inhibiting the transcriptional coactivator activity of myocardin. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Foxo4 (ARP38710_P050) antibody |
Blocking Peptide |
For anti-Foxo4 (ARP38710_P050) antibody is Catalog # AAP38710 |
Uniprot ID |
Q99MK2 |
Protein Name |
Histone acetyltransferase KAT5 |
Protein Accession # |
NP_001005872 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001005872 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Foxo4 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Mouse Pancreas
| WB Suggested Anti-Foxo4 Antibody Titration: 1.0 ug/ml Positive Control: Mouse Pancreas |
|
|