DLX5 Antibody - N-terminal region (ARP38585_T100)

• Product Number: ARP38585_T100
• Name: DLX5 Antibody - N-terminal region (ARP38585_T100)
• Protein Size (# AA): 289 amino acids
• Molecular Weight: 31kDa
• NCBI Gene Id: 1749
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Distal-less homeobox 5
• Alias Symbols: SHFM1, SHFM1D
• Peptide Sequence: Synthetic peptide located within the following region: MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: van (2006) Calcif. Tissue Int. 78 (2), 98-102
• Description of Target: DLX5 is a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. This protein may play a role in bone development and fracture healing. Mutation in its gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation.This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation.
• Protein Interactions: UBC; SOX8; SPEN; NCOA2; SOX10; MAGED1; MSX2; MSX1; HOXC8; DLX5; DLX2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-DLX5 (ARP38585_T100) antibody is Catalog # AAP38585 (Previous Catalog # AAPP20775)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DLX5
• Uniprot ID: P56178
• Protein Name: Homeobox protein DLX-5
• Protein Accession #: NP_005212
• Purification: Protein A purified
• Nucleotide Accession #: NM_005221
• Tested Species Reactivity: Human
• Gene Symbol: DLX5
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human Heart
  
  Human Heart
• Image 2: Human Liver
  
  Human Liver
• Image 3: Transfected 293T
  
  WB Suggested Anti-DLX5 Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Transfected 293T