SIM2 Antibody - N-terminal region (ARP38551_P050)

Data Sheet
 
Product Number ARP38551_P050
Product Page www.avivasysbio.com/sim2-antibody-n-terminal-region-arp38551-p050.html
Name SIM2 Antibody - N-terminal region (ARP38551_P050)
Protein Size (# AA) 667 amino acids
Molecular Weight 73 kDa
NCBI Gene Id 6493
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Single-minded homolog 2 (Drosophila)
Alias Symbols SIM, bHLHe15, HMC13F06, HMC29C01
Peptide Sequence Synthetic peptide located within the following region: MKEKSKNAAKTRREKENGEFYELAKLLPLPSAITSQLDKASIIRLTTSYL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Laffin,B., (2008) Mol. Cell. Biol. 28 (6), 1936-1946
Description of Target SIM1 and SIM2 genes are Drosophila single-minded (sim) gene homologs. The Drosophila sim gene encodes a transcription factor that is a master regulator of fruit fly neurogenesis. SIM2 maps within the so-called Down syndrome chromosomal region. Based on t
Protein Interactions Dlg4; HSP90AA1; ARIH1; UBC; PARK2; ARNT; ARNT2; EPO;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-SIM2 (ARP38551_P050) antibody
Blocking Peptide For anti-SIM2 (ARP38551_P050) antibody is Catalog # AAP38551 (Previous Catalog # AAPP20742)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SIM2
Uniprot ID Q14190
Protein Name Single-minded homolog 2
Publications

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). 23103828

Protein Accession # NP_005060
Purification Affinity Purified
Nucleotide Accession # NM_005069
Tested Species Reactivity Human
Gene Symbol SIM2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human kidney
WB Suggested Anti-SIM2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human kidney
Image 2
Western Blot
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Canonical 73 kDa isoform is identified.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com