Product Number |
ARP38551_P050 |
Product Page |
www.avivasysbio.com/sim2-antibody-n-terminal-region-arp38551-p050.html |
Name |
SIM2 Antibody - N-terminal region (ARP38551_P050) |
Protein Size (# AA) |
667 amino acids |
Molecular Weight |
73 kDa |
NCBI Gene Id |
6493 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Single-minded homolog 2 (Drosophila) |
Alias Symbols |
SIM, bHLHe15, HMC13F06, HMC29C01 |
Peptide Sequence |
Synthetic peptide located within the following region: MKEKSKNAAKTRREKENGEFYELAKLLPLPSAITSQLDKASIIRLTTSYL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Laffin,B., (2008) Mol. Cell. Biol. 28 (6), 1936-1946 |
Description of Target |
SIM1 and SIM2 genes are Drosophila single-minded (sim) gene homologs. The Drosophila sim gene encodes a transcription factor that is a master regulator of fruit fly neurogenesis. SIM2 maps within the so-called Down syndrome chromosomal region. Based on t |
Protein Interactions |
Dlg4; HSP90AA1; ARIH1; UBC; PARK2; ARNT; ARNT2; EPO; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
Relative Expression (Western Blot) |
|
|
Datasheets/Manuals |
Printable datasheet for anti-SIM2 (ARP38551_P050) antibody |
Blocking Peptide |
For anti-SIM2 (ARP38551_P050) antibody is Catalog # AAP38551 (Previous Catalog # AAPP20742) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SIM2 |
Uniprot ID |
Q14190 |
Protein Name |
Single-minded homolog 2 |
Publications |
Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). 23103828 |
Protein Accession # |
NP_005060 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_005069 |
Tested Species Reactivity |
Human |
Gene Symbol |
SIM2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human kidney
| WB Suggested Anti-SIM2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human kidney |
|
Image 2 | Western Blot
| 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Canonical 73 kDa isoform is identified. |
|