NRF1 Antibody - N-terminal region (ARP38542_P050)

• Product Number: ARP38542_P050
• Name: NRF1 Antibody - N-terminal region (ARP38542_P050)
• Protein Size (# AA): 503 amino acids
• Molecular Weight: 53kDa
• NCBI Gene Id: 4899
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Nuclear respiratory factor 1
• Alias Symbols: ALPHA-PAL
• Peptide Sequence: Synthetic peptide located within the following region: MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPED
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ramachandran,B., (2008) J. Biol. Chem. 283 (18), 11935-11946
• Description of Target: NRF1 is a phosphorylated nuclear protein with a bZIP domain. This protein homodimerizes and functions as a transcription factor that activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. This gene encodes a protein that homodimerizes and functions as a transcription factor which activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. Alternate transcriptional splice variants, which encode the same protein, have been characterized. Additional variants encoding different protein isoforms have been described but they have not been fully characterized. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene and for 'nuclear factor (erythroid-derived 2)-like 1' which has an official symbol of NFE2L1.
• Protein Interactions: POGZ; TRAF2; SP4; FHL2; DYNLL1; CSNK2B; CSNK2A1; UBC; HHV8GK18_gp81; CEBPB; PARP1; PPRC1; MAFF; PPARGC1A; Dynlt1b; CDK1; MRPL57; TFAM;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-NRF1 (ARP38542_P050) antibody is Catalog # AAP38542 (Previous Catalog # AAPP20733)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NRF1
• Uniprot ID: Q16656
• Protein Name: Nuclear respiratory factor 1
• Sample Type Confirmation:

  There is BioGPS gene expression data showing that NRF1 is expressed in HEK293T

• Protein Accession #: NP_005002
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005011
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: NRF1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Image 1: Mouse endothelial
  
  NRF1 antibody - N-terminal region (ARP38542_P050) validated by WB using Mouse endothelial cells at 1:500.
• Image 2: Skeletal muscle
  
  Rabbit Anti-NRF1 antibody
  Catalog Number: ARP38542
  Formalin Fixed Paraffin Embedded Tissue: Human Adult Skeletal muscle
  Observed Staining: Cytoplasm in hepatocytes
  Primary Antibody Concentration: 1:600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 – 2.0 sec
  
• Image 3: Human 293T
  
  WB Suggested Anti-NRF1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Transfected 293TThere is BioGPS gene expression data showing that NRF1 is expressed in HEK293T
• Image 4: Hum. Fetal Liver
  
  Hum. Fetal Liver