| Product Number |
ARP38506_P050 |
| Product Page |
www.avivasysbio.com/lrrfip1-antibody-n-terminal-region-arp38506-p050.html |
| Name |
LRRFIP1 Antibody - N-terminal region (ARP38506_P050) |
| Protein Size (# AA) |
784 amino acids |
| Molecular Weight |
86kDa |
| NCBI Gene Id |
9208 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Leucine rich repeat (in FLII) interacting protein 1 |
| Description |
|
| Alias Symbols |
GCF2, TRIP, FLAP1, GCF-2, FLAP-1, HUFI-1, FLIIAP1 |
| Peptide Sequence |
Synthetic peptide located within the following region: AEAREIRMKELERQQKEEDSERYSRRSRRNTSASDEDERMSVGSRGSLRV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Olsen,J.V., (2006) Cell 127 (3), 635-648 |
| Description of Target |
LRRFIP1 is a transcriptional repressor which preferentially binds to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA. LRRFIP1 may control smooth muscle cells proliferation following artery injury throu |
| Protein Interactions |
CEP44; MED4; UBC; LGR4; RNF2; C14orf166; RTCB; RPLP0; RFC2; PRKDC; MRE11A; FLII; EPRS; DHX9; DDX1; DPY30; FKBP3; DYNC1H1; Grip; GRIP1; EP300; CTNNB1; MYD88; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-LRRFIP1 (ARP38506_P050) antibody |
| Blocking Peptide |
For anti-LRRFIP1 (ARP38506_P050) antibody is Catalog # AAP38506 (Previous Catalog # AAPS04402) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human LRRFIP1 |
| Uniprot ID |
Q32MZ4-2 |
| Protein Name |
Leucine-rich repeat flightless-interacting protein 1 |
| Publications |
Comparative Proteomics Unveils LRRFIP1 as a New Player in the DAPK1 Interactome of Neurons Exposed to Oxygen and Glucose Deprivation. Antioxidants (Basel). 9, (2020). 33265962 |
| Protein Accession # |
NP_004726 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_004735 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
LRRFIP1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 90%; Zebrafish: 100% |
| Image 1 | hepatitis C virus and 293 transfection
 | Sample Type: Hepatitis C Virus & 293 TransfectionsPrimary Dilution: 1ug/mL |
|
| Image 2 | Human NCIH226
 | WB Suggested Anti-LRRFIP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: NCI-H226 cell lysate |
|
