POU4F2 Antibody - middle region (ARP38502_P050)
Data Sheet
Product Number ARP38502_P050
Product Page www.avivasysbio.com/pou4f2-antibody-middle-region-arp38502-p050.html
Product Name POU4F2 Antibody - middle region (ARP38502_P050)
Size 100 ul
Gene Symbol POU4F2
Alias Symbols BRN3.2, BRN3B, Brn-3b
Protein Size (# AA) 409 amino acids
Molecular Weight 43kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 5458
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name POU class 4 homeobox 2
Target Reference Qiu,F., (2008) J. Neurosci. 28 (13), 3392-3403
Description of Target POU4F2 is a member of the POU-domain family of transcription factors. POU-domain proteins have been observed to play important roles in control of cell identity in several systems. A class IV POU-domain protein, POU4F2 is found in human retina exclusively within a subpopulation of ganglion cells where it may play a role in determining or maintaining the identities of a small subset of visual system neurons. POU4F2 is a member of the POU-domain family of transcription factors. POU-domain proteins have been observed to play important roles in control of cell identity in several systems. A class IV POU-domain protein, POU4F2 is found in human retina exclusively within a subpopulation of ganglion cells where it may play a role in determining or maintaining the identities of a small subset of visual system neurons.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-448 DB082745.1 1-448 449-638 BY796838.2 438-627 639-741 U06233.1 606-708 742-793 X71488.1 62-113 794-2552 U06233.1 761-2519 2553-3141 U06233.1 2522-3110
Tips Information

See our General FAQ page.

The following related protocols are available on www.avivasysbio.com
Blocking Peptide For anti-POU4F2 (ARP38502_P050) antibody is Catalog # AAP38502 (Previous Catalog # AAPS05402)
Datasheets/Manuals Printable datasheet for anti-POU4F2 (ARP38502_P050) antibody
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human POU4F2
Complete computational species homology data Anti-POU4F2 (ARP38502_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express POU4F2.
Peptide Sequence Synthetic peptide located within the following region: LEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAGI
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Swissprot Id Q12837
Protein Name POU domain, class 4, transcription factor 2
Protein Accession # NP_004566
Purification Affinity Purified
Protein Interactions ESR1;
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express POU4F2.
Nucleotide Accession # NM_004575
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Jurkat
WB Suggested Anti-POU4F2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com