ONECUT1 Antibody - middle region (ARP38481_P050)

• Product Number: ARP38481_P050
• Name: ONECUT1 Antibody - middle region (ARP38481_P050)
• Protein Size (# AA): 465 amino acids
• Molecular Weight: 51kDa
• NCBI Gene Id: 3175
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: One cut homeobox 1
• Alias Symbols: HNF6, HNF-6, HNF6A
• Peptide Sequence: Synthetic peptide located within the following region: ITISQQLGLELSTVSNFFMNARRRSLDKWQDEGSSNSGNSSSSSSTCTKA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Jiang,X., (2008) Oncol. Rep. 19 (1), 157-163
• Description of Target: ONECUT1 belongs to the CUT homeobox family. It contains 1 CUT DNA-binding domain and 1 homeobox DNA-binding domain. It is a transcriptional activator. ONECUT1 binds the consensus sequence 5'-DHWATTGAYTWWD-3' on a variety of gene promoters such as those of HNF3B and TTR. It is important for liver genes transcription.
• Protein Interactions: NR0B2; KAT2B; FOXA2; CREBBP; NR3C1; FOXA1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-ONECUT1 (ARP38481_P050) antibody is Catalog # AAP38481 (Previous Catalog # AAPP23190)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ONECUT1
• Uniprot ID: Q9UBC0
• Protein Name: Hepatocyte nuclear factor 6
• Publications:

  Yuan, X.-W. et al. Hepatocyte nuclear factor 6 suppresses the migration and invasive growth of lung cancer cells through p53 and the inhibition of epithelial-mesenchymal transition. J. Biol. Chem. 288, 31206-16 (2013). 24022481

• Protein Accession #: NP_004489
• Purification: Affinity Purified
• Nucleotide Accession #: NM_004498
• Tested Species Reactivity: Human
• Gene Symbol: ONECUT1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
• Image 1: Human Brain, cerebellum
  
  Immunohistochemistry with Human Brain, cerebellum tissue at an antibody concentration of 5.0ug/ml using anti-ONECUT1 antibody (ARP38481_P050)
• Image 2: Human Jurkat
  
  WB Suggested Anti-ONECUT1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Jurkat cell lysate