| Product Number |
ARP38429_P050 |
| Product Page |
www.avivasysbio.com/klf4-antibody-n-terminal-region-arp38429-p050.html |
| Name |
Klf4 Antibody - N-terminal region (ARP38429_P050) |
| Protein Size (# AA) |
474 amino acids |
| Molecular Weight |
51kDa |
| NCBI Gene Id |
16600 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Kruppel-like factor 4 (gut) |
| Alias Symbols |
Zi, EZF, Gkl, Zie, Gklf |
| Peptide Sequence |
Synthetic peptide located within the following region: MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRPAGAPTNRWREELSH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of Klf4 remains unknown. |
| Protein Interactions |
Rad21; Smarca4; Tsix; Apc; Pou5f1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Klf4 (ARP38429_P050) antibody |
| Blocking Peptide |
For anti-Klf4 (ARP38429_P050) antibody is Catalog # AAP38429 (Previous Catalog # AAPP20618) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q60793 |
| Protein Name |
Krueppel-like factor 4 |
| Protein Accession # |
NP_034767 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_010637 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
Klf4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Sheep |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 93%; Rat: 86%; Sheep: 93% |
| Image 1 | Mouse Kidney
 | WB Suggested Anti-Klf4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Mouse Kidney |
| | Image 2 | Human lung cell line
 | Human lung cell line |
|
|
