KLF11 Antibody - C-terminal region (ARP38365_P050)

Data Sheet
 
Product Number ARP38365_P050
Product Page www.avivasysbio.com/klf11-antibody-c-terminal-region-arp38365-p050.html
Name KLF11 Antibody - C-terminal region (ARP38365_P050)
Protein Size (# AA) 512 amino acids
Molecular Weight 55kDa
NCBI Gene Id 8462
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Kruppel-like factor 11
Alias Symbols FKLF, FKLF1, MODY7, TIEG2, Tieg3
Peptide Sequence Synthetic peptide located within the following region: KFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Hromas,R., (er) J. Clin. Endocrinol. Metab. (2008) In press
Description of Target KLF11 (TIEG2) is a pancreas-enriched transcription factor that has elicited significant attention because of its role as negative regulator of exocrine cell growth in vitro and in vivo. It plays a role in the regulation of pancreatic beta cell physiology, and its variants may contribute to the development of diabetes.
Protein Interactions APPBP2; TXNDC9; APH1A; TIMM13; YWHAZ; CLU; SIN3A; MAPK1; ATXN1; CBX5; CBX3; CBX1; EP300; ELAVL1; UBC; HDAC1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KLF11 (ARP38365_P050) antibody
Blocking Peptide For anti-KLF11 (ARP38365_P050) antibody is Catalog # AAP38365 (Previous Catalog # AAPP20551)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human KLF11
Uniprot ID O14901
Protein Name Krueppel-like factor 11
Publications

Chronic Social Stress and Ethanol Increase Expression of KLF11, a Cell Death Mediator, in Rat Brain. Neurotox Res. 28, 18-31 (2015). 25739536

Protein Accession # NP_003588
Purification Affinity Purified
Nucleotide Accession # NM_003597
Tested Species Reactivity Human
Gene Symbol KLF11
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human 721_B
WB Suggested Anti-KLF11 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com