TRIM21 Antibody - C-terminal region (ARP38248_T100)

Data Sheet
 
Product Number ARP38248_T100
Product Page www.avivasysbio.com/trim21-antibody-c-terminal-region-arp38248-t100.html
Name TRIM21 Antibody - C-terminal region (ARP38248_T100)
Protein Size (# AA) 475 amino acids
Molecular Weight 54kDa
NCBI Gene Id 6737
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Tripartite motif containing 21
Alias Symbols SSA, RO52, SSA1, RNF81, Ro/SSA
Peptide Sequence Synthetic peptide located within the following region: YNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Yamochi,T., (2008) Biochem. Biophys. Res. Commun. 370 (1), 195-199
Description of Target TRIM21 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM21 is part of the RoSSA ribonucleoprotein, which includes a single polypeptide and one of four small RNA molecules. The RoSSA particle localizes to both the cytoplasm and the nucleus. RoSSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus.This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The encoded protein is part of the RoSSA ribonucleoprotein, which includes a single polypeptide and one of four small RNA molecules. The RoSSA particle localizes to both the cytoplasm and the nucleus. RoSSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus. Alternatively spliced transcript variants for this gene have been described but the full-length nature of only one has been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions TRIM39; IGHV4-31; TXN2; GRAP; UBE2I; TRIM21; IGHG1; USP15; HAUS2; UBE2D2; UBC; FBXO6; UBD; NPM1; PAN2; ROR1; NOS2; MYC; IQCB1; USP2; VCP; USP4; CDC34; CBL; UBC4; UBE2C; UBE2L3; UBE2H; UBE2D1; TROVE2; TRIM27; MNAT1; FCGR2A; CD52; DCP2; ZFPM1; TRIM5; TRIM8;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TRIM21 (ARP38248_T100) antibody
Blocking Peptide For anti-TRIM21 (ARP38248_T100) antibody is Catalog # AAP38248 (Previous Catalog # AAPP23102)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM21
Uniprot ID P19474
Protein Name E3 ubiquitin-protein ligase TRIM21
Protein Accession # NP_003132
Purification Protein A purified
Nucleotide Accession # NM_003141
Tested Species Reactivity Human
Gene Symbol TRIM21
Predicted Species Reactivity Human, Rat, Cow, Guinea Pig, Horse, Pig, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 77%; Guinea Pig: 77%; Horse: 92%; Human: 100%; Pig: 85%; Rat: 77%; Zebrafish: 77%
Image 1
Transfected 293T
WB Suggested Anti-TRIM21 Antibody Titration: 1.25ug/ml
Positive Control: Transfected 293T
Image 2
Human 786-0 Whole Cell
Host: Rabbit
Target Name: TRIM21
Sample Tissue: Human 786-0 Whole Cell
Antibody Dilution: 5ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com