SOX11 Antibody - N-terminal region (ARP38235_P050)

Data Sheet
 
Product Number ARP38235_P050
Product Page www.avivasysbio.com/sox11-antibody-n-terminal-region-arp38235-p050.html
Name SOX11 Antibody - N-terminal region (ARP38235_P050)
Protein Size (# AA) 441 amino acids
Molecular Weight 47kDa
NCBI Gene Id 6664
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name SRY (sex determining region Y)-box 11
Description
Alias Symbols CSS9, MRD27
Peptide Sequence Synthetic peptide located within the following region: MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPDWCKTASGHIK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference DesGroseilliers,M., Cytogenet. Genome Res. 112 (1-2), 176-179 (2006)
Description of Target SOX11 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may function in the developing nervous system and play a role in tumorigenesis.This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may function in the developing nervous system and play a role in tumorigenesis.
Protein Interactions POU3F3; POU3F2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SOX11 (ARP38235_P050) antibody
Blocking Peptide For anti-SOX11 (ARP38235_P050) antibody is Catalog # AAP38235 (Previous Catalog # AAPS05104)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SOX11
Uniprot ID P35716
Protein Name Transcription factor SOX-11
Publications

Cis-regulatory control of corticospinal system development and evolution. Nature. 486, 74-9 (2012). 22678282

Protein Accession # NP_003099
Purification Affinity Purified
Nucleotide Accession # NM_003108
Tested Species Reactivity Human
Gene Symbol SOX11
Predicted Species Reactivity Human, Mouse, Rat, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Image 1
Human Jurkat
WB Suggested Anti-SOX11 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com