Product Number |
ARP38167_P050 |
Product Page |
www.avivasysbio.com/nkx2-2-antibody-n-terminal-region-arp38167-p050.html |
Name |
NKX2-2 Antibody - N-terminal region (ARP38167_P050) |
Protein Size (# AA) |
273 amino acids |
Molecular Weight |
30kDa |
NCBI Gene Id |
4821 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
NK2 homeobox 2 |
Alias Symbols |
NKX2B, NKX2.2 |
Peptide Sequence |
Synthetic peptide located within the following region: MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQ |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Owen,L.A., (er) PLoS ONE 3 (4), E1965 (2008) |
Description of Target |
Nkx2-2 contains 1 homeobox DNA-binding domain which is essential for interaction with OLIG2. Nkx2-2 may be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance. The protein encoded by this gene contains a homeobox domain and may be involved in the morphogenesis of the central nervous system. This gene is found on chromosome 20 near NKX2-4, and these two genes appear to be duplicated on chromosome 14 in the form of TITF1 and NKX2-8. The encoded protein is likely to be a nuclear transcription factor. |
Protein Interactions |
Dlg4; SIN3A; HDAC1; OLIG2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NKX2-2 (ARP38167_P050) antibody |
Blocking Peptide |
For anti-NKX2-2 (ARP38167_P050) antibody is Catalog # AAP38167 (Previous Catalog # AAPP20343) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human NKX2-2 |
Uniprot ID |
O95096 |
Protein Name |
Homeobox protein Nkx-2.2 |
Protein Accession # |
NP_002500 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_002509 |
Tested Species Reactivity |
Human |
Gene Symbol |
NKX2-2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Sheep: 100%; Zebrafish: 100% |
Image 1 | Human Placenta
| WB Suggested Anti-NKX2-2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Human Placenta |
| Image 2 | Hum. Fetal Brain
| Hum. Fetal Brain |
|
|