IRF4 Antibody - N-terminal region (ARP38154_P050)

• Product Number: ARP38154_P050
• Name: IRF4 Antibody - N-terminal region (ARP38154_P050)
• Protein Size (# AA): 451 amino acids
• Molecular Weight: 52 kDa
• NCBI Gene Id: 3662
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Interferon regulatory factor 4
• Alias Symbols: MUM1, LSIRF, SHEP8, NF-EM5
• Peptide Sequence: Synthetic peptide located within the following region: MNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSIF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Lehtonen,A., (2005) J. Immunol. 175 (10), 6570-6579
• Description of Target: IFN regulatory factor (IRF)-4 is a lymphoid/myeloid-restricted member of the IRF transcription factor family that plays an essential role in the homeostasis and function of mature lymphocytes. IRF-4 expression is tightly regulated in resting primary T cells and is transiently induced at the mRNA and protein levels after activation by Ag-mimetic stimuli such as TCR cross-linking or treatment with phorbol ester and calcium ionophore (PMA/ionomycin).
• Protein Interactions: UBC; STAT6; BCL6; TOP1; IRAK1; PRRC2B; YTHDC2; VPS35; PEG10; TLK2; CARM1; IKBKAP; ETV7; BATF; HOXB13; PROX1; HOXC11; FKBP4; SPIB; PRDM1; MYD88; TRAF2; NFATC2; SPI1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Additional Information: WB Information: Jurkat cell lysate. Antibody concentration: 0.5 ug/ml. Gel concentration: 12%.
• Blocking Peptide: For anti-IRF4 (ARP38154_P050) antibody is Catalog # AAP38154 (Previous Catalog # AAPS04906)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IRF4
• Uniprot ID: Q15306
• Protein Name: Interferon regulatory factor 4
• Protein Accession #: NP_002451
• Purification: Affinity Purified
• Nucleotide Accession #: NM_002460
• Tested Species Reactivity: Human
• Gene Symbol: IRF4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
• Image 1: Human Skin
  
  Human Skin
• Image 2: Western Blot
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.