MAZ Antibody - N-terminal region (ARP38146_P050)

• Product Number: ARP38146_P050
• Name: MAZ Antibody - N-terminal region (ARP38146_P050)
• Protein Size (# AA): 477 amino acids
• Molecular Weight: 49 kDa
• NCBI Gene Id: 4150
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: MYC-associated zinc finger protein (purine-binding transcription factor)
• Alias Symbols: PUR1, ZF87, Pur-1, SAF-1, SAF-2, SAF-3, Zif87, ZNF801
• Peptide Sequence: Synthetic peptide located within the following region: FPVFPCTLLAPPFPVLGLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ray,B.K., (2007) J. Immunol. 178 (3), 1774-1782
• Description of Target: MAZ may function as a transcription factor with dual roles in transcription initiation and termination.It binds to two sites, ME1a1 and ME1a2, within the c-myc promoter having greater affinity for the former. It also binds to multiple G/C-rich sites within the promoter of the Sp1 family of transcription factors.
• Protein Interactions: HECW2; MAPK14; BPTF; JUN; FOS; KEAP1; DCC; CSNK2A1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-MAZ (ARP38146_P050) antibody is Catalog # AAP38146 (Previous Catalog # AAPP10733)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAZ
• Uniprot ID: P56270
• Protein Name: Myc-associated zinc finger protein
• Publications:

  Smits, M. et al. Myc-associated zinc finger protein (MAZ) is regulated by miR-125b and mediates VEGF-induced angiogenesis in glioblastoma. FASEB J. 26, 2639-47 (2012). 22415301

• Sample Type Confirmation:

  MAZ is strongly supported by BioGPS gene expression data to be expressed in HEK293T

• Protein Accession #: NP_002374
• Purification: Affinity Purified
• Nucleotide Accession #: NM_002383
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: MAZ
• Predicted Species Reactivity: Human, Mouse, Rat, Pig
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
• Image 1: Human Breast
  
  Human Breast
• Image 2: Mouse Spleen
  
  Host: Mouse
  Target Name: MAZ
  Sample Tissue: Mouse Spleen
  Antibody Dilution: 1ug/ml