Atf4 antibody - N-terminal region (ARP38066_P050)
Data Sheet
Product Number ARP38066_P050
Product Page
Product Name Atf4 antibody - N-terminal region (ARP38066_P050)
Size 100 ul
Gene Symbol Atf4
Alias Symbols Atf-4, C/ATF, CREB2, MGC96460, TAXREB67
Protein Size (# AA) 349 amino acids
Molecular Weight 38kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 11911
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Activating transcription factor 4
Description This is a rabbit polyclonal antibody against Atf4. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: VLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLKPHGFSSDKAGSSEWP
Description of Target The function of Atf4 remains unknown.
Protein Interactions Egln3; Ubc; Hif1a; Satb2; Fam175b; Trib3; Gabbr2; Gabbr1; Jun; Fos; Dapk3; Rps6ka3; Tnfsf11; Prkaca;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-Atf4 (ARP38066_P050) antibody is Catalog # AAP38066
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Complete computational species homology data Anti-Atf4 (ARP38066_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Atf4.
Swissprot Id Q5U4B2
Protein Name Cyclic AMP-dependent transcription factor ATF-4

Kalinec, G. M. et al. Acetaminophen and NAPQI are toxic to auditory cells via oxidative and endoplasmic reticulum stress-dependent pathways. Hear. Res. 313, 26-37 (2014). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rat, Sheep 24793116

Protein Accession # NP_033846
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Atf4.
Nucleotide Accession # NM_009716
Replacement Item This antibody may replace item sc-200 from Santa Cruz Biotechnology.
Conjugation Options

ARP38066_P050-FITC Conjugated

ARP38066_P050-HRP Conjugated

ARP38066_P050-Biotin Conjugated

CB Replacement sc-200; sc-22800; sc-390063; sc-7583
Species Reactivity Cow, Dog, Guinea Pig, Human, Mouse, Rat, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 92%; Rat: 100%; Sheep: 93%
Image 1
Mouse Kidney
Atf4 antibody - N-terminal region (ARP38066_P050) validated by WB using Mouse Kidney at 0.2-1 ug/ml.
Image 2
Mouse Kidney
WB Suggested Anti-Atf4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Mouse Kidney
Image 3
Mouse Kidney
Host: Rabbit
Target Name: ATF4
Sample Tissue: Mouse Kidney
Antibody Dilution: 1ug/ml
Image 4
Mouse Kidney
Host: Mouse
Target Name: ATF4
Sample Tissue: Mouse Kidney
Antibody Dilution: 1ug/ml

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |