TADA2L Antibody - N-terminal region (ARP38044_P050)

Data Sheet
 
Product Number ARP38044_P050
Product Page www.avivasysbio.com/tada2l-antibody-n-terminal-region-arp38044-p050.html
Name TADA2L Antibody - N-terminal region (ARP38044_P050)
Protein Size (# AA) 305 amino acids
Molecular Weight 36kDa
NCBI Gene Id 6871
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Transcriptional adaptor 2A
Alias Symbols ADA2, ADA2A, KL04P, hADA2, TADA2L
Peptide Sequence Synthetic peptide located within the following region: MDRLGPFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Yang,M., (2008) Cancer Biol. Ther. 7 (1), 120-128
Description of Target Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated gene transcription by interacting functionally with the general transcription machinery bound at the basal promoter. Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter. TADA2L is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex.Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated gene transcription by interacting functionally with the general transcription machinery bound at the basal promoter. Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter. The protein encoded by this gene is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex. Two transcript variants encoding different isoforms have been identified for this gene.
Protein Interactions MFAP1; MAGOH; KPNA2; FBF1; PRPF31; PPP1R16B; ZFYVE26; SF3A3; FARS2; MTX2; EIF4E2; FAM127C; KLHL38; TTC9C; ZNF564; TEKT4; LOC149950; KLC4; TTC23; GPSM3; CDCA7L; C1orf109; CCHCR1; PRKAB2; ARNT2; USP22; TADA3; HNF4A; LYN; HSP90AA1; KAT2B; MCPH1; PAXIP1; SUPT
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TADA2A (ARP38044_P050) antibody
Blocking Peptide For anti-TADA2A (ARP38044_P050) antibody is Catalog # AAP38044 (Previous Catalog # AAPP20219)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TADA2L
Uniprot ID Q9BVJ0
Protein Name Transcriptional adapter 2-alpha
Sample Type Confirmation

TADA2A is strongly supported by BioGPS gene expression data to be expressed in 721_B, Jurkat

Protein Accession # NP_597683
Purification Affinity Purified
Nucleotide Accession # NM_133439
Tested Species Reactivity Human
Gene Symbol TADA2A
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Image 1
Human Jurkat
WB Suggested Anti-TADA2L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate.TADA2A is strongly supported by BioGPS gene expression data to be expressed in Jurkat
Image 2
Human 721_B
Host: Rabbit
Target Name: TADA2A
Sample Type: 721_B
Antibody Dilution: 1.0ug/mlTADA2A is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com