ERCC3 Antibody - N-terminal region (ARP37963_P050)

Data Sheet
 
Product Number ARP37963_P050
Product Page www.avivasysbio.com/ercc3-antibody-n-terminal-region-arp37963-p050.html
Name ERCC3 Antibody - N-terminal region (ARP37963_P050)
Protein Size (# AA) 782 amino acids
Molecular Weight 89kDa
NCBI Gene Id 2071
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Excision repair cross-complementing rodent repair deficiency, complementation group 3
Description
Alias Symbols XPB, BTF2, Ssl2, TTD2, GTF2H, RAD25, TFIIH
Peptide Sequence Synthetic peptide located within the following region: MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target ERCC3 is an ATP-dependent DNA helicase that functions in nucleotide excision repair and complements xeroderma pigmentosum group B mutations. It also is the 89 kDa subunit of basal transcription factor 2 (TFIIH) and thus functions in class II transcription.
Protein Interactions XIAP; CEP70; UBC; rev; SRPK2; CDK7; TP53; E2F1; CDK8; CCNC; GTF2H5; ERCC2; MSANTD2; UVSSA; POLR2C; KPNA3; RAD52; MMS19; SIX5; GTF2H4; GTF2H3; GTF2H1; tat; COPS2; GTF2H2; NEDD8; ERCC6; POLR2A; AR; CCNH; MYC; MNAT1; ZSCAN1; ATF7IP; GCN1L1; ERCC5; BCR; PSMC5
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ERCC3 (ARP37963_P050) antibody
Blocking Peptide For anti-ERCC3 (ARP37963_P050) antibody is Catalog # AAP37963 (Previous Catalog # AAPP23267)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ERCC3
Uniprot ID P19447
Protein Name TFIIH basal transcription factor complex helicase XPB subunit
Publications

A Recurrent ERCC3 Truncating Mutation Confers Moderate Risk for Breast Cancer. Cancer Discov. 6, 1267-1275 (2016). 27655433

Sample Type Confirmation

ERCC3 is supported by BioGPS gene expression data to be expressed in HCT15

Protein Accession # NP_000113
Purification Affinity Purified
Nucleotide Accession # NM_000122
Tested Species Reactivity Human
Gene Symbol ERCC3
Predicted Species Reactivity Human, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 79%; Human: 100%; Pig: 93%; Rabbit: 79%; Rat: 79%; Yeast: 90%; Zebrafish: 79%
Image 1
Human HCT15
WB Suggested Anti-ERCC3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HCT15 cell lysateERCC3 is supported by BioGPS gene expression data to be expressed in HCT15
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com