TSG101 Antibody - middle region (ARP37911_T100)

Data Sheet
 
Product Number ARP37911_T100
Product Page www.avivasysbio.com/tsg101-antibody-middle-region-arp37911-t100.html
Name TSG101 Antibody - middle region (ARP37911_T100)
Protein Size (# AA) 391 amino acids
Molecular Weight 43kDa
NCBI Gene Id 22088
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Tumor susceptibility gene 101
Alias Symbols CC2, AI255943
Peptide Sequence Synthetic peptide located within the following region: YMPGMPSGISAYPSGYPPNPSGYPGCPYPPAGPYPATTSSQYPSQPPVTT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Stefan,M., et al., (er) BMC Genomics 6, 157 (2005)
Description of Target TSG101 has a direct role in the control of growth and differentiation in primary epithelial cells. It is required for normal cell function of embryonic and adult tissues but that this gene is not a tumor suppressor for sporadic forms of breast cancer.
Protein Interactions Nr3c2; Ndfip1; SH3KBP1; Ppp1cc; Gjd3; Gjb3; Gjc1; Gja1; Ubc; Mgrn1; Tsg101; Nfe2; Ikbkg; Gmcl1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TSG101 (ARP37911_T100) antibody
Blocking Peptide For anti-TSG101 (ARP37911_T100) antibody is Catalog # AAP37911 (Previous Catalog # AAPP10091)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Uniprot ID Q61187
Protein Name Tumor susceptibility gene 101 protein
Protein Accession # NP_068684
Purification Protein A purified
Nucleotide Accession # NM_021884
Tested Species Reactivity Mouse
Gene Symbol TSG101
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 87%; Dog: 87%; Goat: 87%; Guinea Pig: 93%; Horse: 87%; Human: 93%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Yeast: 79%
Image 1
Mouse NIH-3T3
WB Suggested Anti-TSG101 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: NIH/3T3 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com