Trp53 antibody - N-terminal region (ARP37897_P050)
Data Sheet
 
Product Number ARP37897_P050
Product Page www.avivasysbio.com/trp53-antibody-n-terminal-region-arp37897-p050.html
Product Name Trp53 antibody - N-terminal region (ARP37897_P050)
Size 100 ul
Gene Symbol Trp53
Alias Symbols bbl, bfy, bhy, p53, p44, Tp53
Protein Size (# AA) 390 amino acids
Molecular Weight 43kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 22059
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Transformation related protein 53
Description This is a rabbit polyclonal antibody against Trp53. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).Trp53,transformation related protein 53,bbl; bfy; bhy; p44; p53; Tp53; Trp53,cellular tumor antigen p53,cellular tumor antigen p53,OTTMUSP00000006194,tumor supressor p53,tumor suppressor p53,p53 cellular tumor antigen
Peptide Sequence Synthetic peptide located within the following region: EEFFEGPSEALRVSGAPAAQDPVTETPGPVAPAPATPWPLSSFVPSQKTY
Description of Target Trp53 is a protein found in elevated levels in a great variety of transformed cells.
Protein Interactions PRKAA1; Rnf128; Ndn; Herc2; Rchy1; Rps26; Rpl11; Cdkn2a; Bcl2l1; Daxx; Mdm2; Wwox; Mapk8; Smyd1; Ubc; Twist1; Pten; Bard1; Ep300; Sumo1; Trp73; Trp63; Strm; Nqo1; Mif; Hspa1b; Hipk2; Axin1; Zbtb7c; Topors; Gsk3b; Foxp3; Huwe1; Park7; Ccng1; NUMB; Skil; Cu
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-Trp53 (ARP37897_P050) antibody is Catalog # AAP37897 (Previous Catalog # AAPP20019)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Complete computational species homology data Anti-Trp53 (ARP37897_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Trp53.
Swissprot Id Q549C9
Protein Name Cellular tumor antigen p53 RuleBase RU003304
Protein Accession # NP_035770
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Trp53.
Nucleotide Accession # NM_011640
Replacement Item This antibody may replace item sc-100 from Santa Cruz Biotechnology.
Conjugation Options

ARP37897_P050-FITC Conjugated

ARP37897_P050-HRP Conjugated

ARP37897_P050-Biotin Conjugated

CB Replacement sc-100; sc-1311-R; sc-1312; sc-1313; sc-1314; sc-1315; sc-17846; sc-29436; sc-374087; sc-393031; sc-44219; sc-53397; sc-55476; sc-56179; sc-56182; sc-6243; sc-65226; sc-71815; sc-71818; sc-71819; sc-71820; sc-71821; sc-98; sc-99
Species Reactivity Mouse, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Mouse: 100%; Rat: 93%
Image 1
Mouse SP2/0
WB Suggested Anti-Trp53 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: SP2/0 cell lysate
Image 2
Mouse
WB Suggested Anti-TRP53 Antibody
Positive Control: Lane 1: 40ug C57/B6 control mouse G.I. Lane 2: 40ug C57/B6 mouse G.I. treated with Irinotecan Lane 3: 40ug p53 KO HCT-116 cells Lane 4: 40ug C57/B6 mouse treated with 15 Gy ionizing radiation
Primary Antibody Dilution : 1:1000
Secondary Antibody : Goat anti-rabbit-HRP
Secondry Antibody Dilution : 1:2500
Submitted by: Brian Leibowitz, University of Pittsburgh
Image 3
Mouse Pancreas
Host: Rabbit
Target Name: TP53
Sample Tissue: Mouse Pancreas
Antibody Dilution: 1ug/ml
Image 4
Mouse Pancreas
Host: Mouse
Target Name: TP53
Sample Tissue: Mouse Pancreas
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com