| Product Number |
ARP37832_P050 |
| Product Page |
www.avivasysbio.com/tbx18-antibody-c-terminal-region-arp37832-p050.html |
| Name |
TBX18 Antibody - C-terminal region (ARP37832_P050) |
| Protein Size (# AA) |
607 amino acids |
| Molecular Weight |
65 kDa |
| NCBI Gene Id |
9096 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
T-box 18 |
| Alias Symbols |
CAKUT2 |
| Peptide Sequence |
Synthetic peptide located within the following region: NQTHQGSYNTFRLHSPCALYGYNFSTSPKLAASPEKIVSSQGSFLGSSPS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
TBX18 is a probable transcriptional regulator involved in developmental processes. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
| Relative Expression (Western Blot) |
 |
|
| Datasheets/Manuals |
Printable datasheet for anti-TBX18 (ARP37832_P050) antibody |
| Blocking Peptide |
For anti-TBX18 (ARP37832_P050) antibody is Catalog # AAP37832 (Previous Catalog # AAPP09062) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human TBX18 |
| Uniprot ID |
O95935 |
| Protein Name |
T-box transcription factor TBX18 |
| Protein Accession # |
XP_943361 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
XM_938268 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
TBX18 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92% |
| Image 1 | Mouse Liver
 | Host: Mouse
Target Name: TBX18
Sample Tissue: Mouse Liver
Antibody Dilution: 1ug/ml |
|
| Image 2 | 293T, HeLa
 | Host: Rabbit
Target: TBX18
Positive control (+): 293T (2T)
Negative control (-): HeLa (HL)
Antibody concentration: 0.5ug/ml |
|
| Image 3 | Human Breast
 | IHC Information: Paraffin embedded breast tissue, tested with an antibody dilution of 5 ug/ml. |
|
| Image 4 | Human
 | IHC Information: Paraffin embedded renaltubules tissue, tested with an antibody dilution of 5 ug/ml. |
|
| Image 5 | Western Blot
 | 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/mL. |
|
