G3BP Antibody - N-terminal region (ARP37713_T100)

Data Sheet
 
Product Number ARP37713_T100
Product Page www.avivasysbio.com/g3bp-antibody-n-terminal-region-arp37713-t100.html
Name G3BP Antibody - N-terminal region (ARP37713_T100)
Protein Size (# AA) 466 amino acids
Molecular Weight 51kDa
NCBI Gene Id 10146
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name GTPase activating protein (SH3 domain) binding protein 1
Description
Alias Symbols G3BP, HDH-VIII
Peptide Sequence Synthetic peptide located within the following region: EVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kociok,N., et al., (1999) J. Cell. Biochem. 74 (2), 194-201
Description of Target G3BP is one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
Protein Interactions UBC; USP10; FXR2; MDM2; RNF2; BMI1; RPS27L; EDC4; RPL35; RPL14; EIF2B3; EIF3C; PTBP1; PIN1; PA2G4; YBX1; HNRNPU; FAU; SH3RF2; TARDBP; FBXO25; RIOK2; SND1; VCAM1; env; ITGA4; IL7R; FN1; EPHA8; DTX1; PABPC1; PAXIP1; ESR1; APP; NOLC1; TPM4; LCK; CSK; KCND3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-G3BP1 (ARP37713_T100) antibody
Blocking Peptide For anti-G3BP1 (ARP37713_T100) antibody is Catalog # AAP37713 (Previous Catalog # AAPP09045)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human G3BP
Uniprot ID Q13283
Protein Name Ras GTPase-activating protein-binding protein 1
Publications

Combined structural, biochemical and cellular evidence demonstrates that both FGDF motifs in alphavirus nsP3 are required for efficient replication. Open Biol. 6, (2016). 27383630

Coxsackievirus counters the host innate immune response by blocking type III interferon expression. J. Gen. Virol. 97, 1-12 (2016). 26935471

Foot-and-Mouth Disease Virus Leader Protease Cleaves G3BP1 and G3BP2 and Inhibits Stress Granule Formation. J Virol. 93, (2019). 30404792

Single-Molecule Imaging of mRNA Localization and Regulation during the Integrated Stress Response. Mol Cell. 73, 946-958.e7 (2019). 30661979

Stress granule components G3BP1 and G3BP2 play a proviral role early in Chikungunya virus replication. J Virol. 89, 4457-69 (2015). 25653451

Protein Accession # NP_005745
Purification Protein A purified
Nucleotide Accession # NM_005754
Tested Species Reactivity Human
Gene Symbol G3BP1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-G3BP Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Image 2
HepG2
Host: Rabbit
Target Name: G3BP
Sample Type: HepG2
Lane A: Primary Antibody
Lane B: Primary Antibody + Blocking Peptide
Primary Antibody Concentration: 2.5ug/mL
Peptide Concentration: 2.0ug/mL
Lysate Quantity: 25ug/lane
Gel Concentration: 12%
Image 3
293T Cell Lysate, Human Liver
Host: Rabbit
Target: G3BP1
Positive control (+): 293T Cell Lysate (2T)
Negative control (-): Human Liver (LI)
Antibody concentration: 0.5ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com