Product Number |
ARP37678_P050 |
Product Page |
www.avivasysbio.com/kcnab2-antibody-middle-region-arp37678-p050.html |
Name |
KCNAB2 Antibody - middle region (ARP37678_P050) |
Protein Size (# AA) |
367 amino acids |
Molecular Weight |
40kDa |
Subunit |
beta-2 |
NCBI Gene Id |
8514 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Potassium voltage-gated channel, shaker-related subfamily, beta member 2 |
Alias Symbols |
AKR6A5, KCNA2B, HKvbeta2, KV-BETA-2, HKvbeta2.1, HKvbeta2.2 |
Peptide Sequence |
Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Gu,C., et al., (2003) Science 301 (5633), 646-649 |
Description of Target |
The functions of Voltage-gated potassium (Kv) channels include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNAB2 is a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. |
Protein Interactions |
KCNAB2; SIRT1; KCNA5; KCNA4; UBC; RPA3; RPA2; RPA1; ATXN1; Nedd4; NEDD4L; SLC39A2; SLC39A1; SQSTM1; CD4; KCNA2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-KCNAB2 (ARP37678_P050) antibody |
Blocking Peptide |
For anti-KCNAB2 (ARP37678_P050) antibody is Catalog # AAP37678 (Previous Catalog # AAPP09012) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human KCNAB2 |
Uniprot ID |
Q13303 |
Protein Name |
Voltage-gated potassium channel subunit beta-2 |
Sample Type Confirmation |
KCNAB2 is strongly supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_003627 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_003636 |
Tested Species Reactivity |
Human, Mouse |
Gene Symbol |
KCNAB2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%; Zebrafish: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-KCNAB2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Jurkat cell lysateKCNAB2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells |
|
Image 2 | Human Jurkat
| WB Suggested Anti-KCNAB2 Antibody Titration: 1.25ug/ml Positive Control: Jurkat cell lysate |
|
Image 3 | Mouse Brain
| Sample Type: P48 Mouse Dilution: 1:2000
tested with brain slices in Immunohistochemistry |
|
Image 4 | Human Kidney
| Rabbit Anti-KCBAB2 Antibody Catalog Number: ARP37678 Paraffin Embedded Tissue: Human Kidney Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|
Image 5 | Human HepG2
| WB Suggested Anti-KCNAB2 antibody Titration: 1 ug/mL Sample Type: Human HepG2 |
|