Product Number |
ARP37674_P050 |
Product Page |
www.avivasysbio.com/grik5-antibody-arp37674-p050.html |
Name |
GRIK5 Antibody (ARP37674_P050) |
Protein Size (# AA) |
980 amino acids |
Molecular Weight |
108kDa |
NCBI Gene Id |
2901 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Glutamate receptor, ionotropic, kainate 5 |
Alias Symbols |
KA2, EAA2, GRIK2, GluK5 |
Peptide Sequence |
Synthetic peptide located within the following region: EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Shibata,H., (2006) Psychiatry Res 141 (1), 39-51 |
Description of Target |
GRIK5 is a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. GRIK5 forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members.This gene encodes a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. The protein encoded by this gene forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Protein Interactions |
LRSAM1; GOLM1; GRID2; GPAA1; DLG4; MLF1; GRIK2; GRIK3; DLG3; GRIA2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-GRIK5 (ARP37674_P050) antibody |
Blocking Peptide |
For anti-GRIK5 (ARP37674_P050) antibody is Catalog # AAP37674 (Previous Catalog # AAPP09008) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GRIK5 |
Uniprot ID |
Q16478 |
Protein Name |
Glutamate receptor, ionotropic kainate 5 |
Sample Type Confirmation |
GRIK5 is supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_002079 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_002088 |
Tested Species Reactivity |
Human |
Gene Symbol |
GRIK5 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB, IHC |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
Image 1 | Human Jurkat
| WB Suggested Anti-GRIK5 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:2500 Positive Control: Jurkat cell lysateGRIK5 is supported by BioGPS gene expression data to be expressed in Jurkat |
|
Image 2 | Human Pineal Tissue
| Rabbit Anti-GRIK5 Antibody Catalog Number: ARP37674_P050 Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Membrane in cell processes Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
|
|