GRIK5 Antibody (ARP37674_P050)

Data Sheet
 
Product Number ARP37674_P050
Product Page www.avivasysbio.com/grik5-antibody-arp37674-p050.html
Name GRIK5 Antibody (ARP37674_P050)
Protein Size (# AA) 980 amino acids
Molecular Weight 108kDa
NCBI Gene Id 2901
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Glutamate receptor, ionotropic, kainate 5
Alias Symbols KA2, EAA2, GRIK2, GluK5
Peptide Sequence Synthetic peptide located within the following region: EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Shibata,H., (2006) Psychiatry Res 141 (1), 39-51
Description of Target GRIK5 is a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. GRIK5 forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members.This gene encodes a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. The protein encoded by this gene forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions LRSAM1; GOLM1; GRID2; GPAA1; DLG4; MLF1; GRIK2; GRIK3; DLG3; GRIA2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GRIK5 (ARP37674_P050) antibody
Blocking Peptide For anti-GRIK5 (ARP37674_P050) antibody is Catalog # AAP37674 (Previous Catalog # AAPP09008)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GRIK5
Uniprot ID Q16478
Protein Name Glutamate receptor, ionotropic kainate 5
Sample Type Confirmation

GRIK5 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_002079
Purification Affinity Purified
Nucleotide Accession # NM_002088
Tested Species Reactivity Human
Gene Symbol GRIK5
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human Jurkat
WB Suggested Anti-GRIK5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: Jurkat cell lysateGRIK5 is supported by BioGPS gene expression data to be expressed in Jurkat
Image 2
Human Pineal Tissue
Rabbit Anti-GRIK5 Antibody
Catalog Number: ARP37674_P050
Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue
Observed Staining: Membrane in cell processes
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com