Helt Antibody - C-terminal region (ARP37537_P050)

Data Sheet
 
Product Number ARP37537_P050
Product Page www.avivasysbio.com/helt-antibody-c-terminal-region-arp37537-p050.html
Name Helt Antibody - C-terminal region (ARP37537_P050)
Protein Size (# AA) 240 amino acids
Molecular Weight 27kDa
NCBI Gene Id 234219
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name helt bHLH transcription factor
Alias Symbols Mgn, Hesl, mega, megane, Heslike, A830086M02
Peptide Sequence Synthetic peptide located within the following region: LPEPDFSYQLHAASPEFPGHSPGEATMFPQGATPGSFPWPPGAARSPALP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Helt is a transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGCG-3' and is required for the development of GABAergic neurons.
Protein Interactions Helt; Hey2; Hes5;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Helt (ARP37537_P050) antibody
Blocking Peptide For anti-Helt (ARP37537_P050) antibody is Catalog # AAP37537
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Helt
Uniprot ID Q7TS99
Protein Name Hairy and enhancer of split-related protein HELT
Protein Accession # NP_776150
Purification Affinity Purified
Nucleotide Accession # NM_173789
Tested Species Reactivity Mouse
Gene Symbol Helt
Predicted Species Reactivity Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 85%; Guinea Pig: 77%; Horse: 85%; Human: 85%; Mouse: 100%; Rabbit: 77%; Rat: 93%
Image 1
Mouse Stomach
Host: Rabbit
Target Name: Helt
Sample Type: Mouse Stomach lysates
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com