Product Number |
ARP37537_P050 |
Product Page |
www.avivasysbio.com/helt-antibody-c-terminal-region-arp37537-p050.html |
Name |
Helt Antibody - C-terminal region (ARP37537_P050) |
Protein Size (# AA) |
240 amino acids |
Molecular Weight |
27kDa |
NCBI Gene Id |
234219 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
helt bHLH transcription factor |
Alias Symbols |
Mgn, Hesl, mega, megane, Heslike, A830086M02 |
Peptide Sequence |
Synthetic peptide located within the following region: LPEPDFSYQLHAASPEFPGHSPGEATMFPQGATPGSFPWPPGAARSPALP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Helt is a transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGCG-3' and is required for the development of GABAergic neurons. |
Protein Interactions |
Helt; Hey2; Hes5; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Helt (ARP37537_P050) antibody |
Blocking Peptide |
For anti-Helt (ARP37537_P050) antibody is Catalog # AAP37537 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Helt |
Uniprot ID |
Q7TS99 |
Protein Name |
Hairy and enhancer of split-related protein HELT |
Protein Accession # |
NP_776150 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_173789 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Helt |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Guinea Pig: 77%; Horse: 85%; Human: 85%; Mouse: 100%; Rabbit: 77%; Rat: 93% |
Image 1 | Mouse Stomach
| Host: Rabbit Target Name: Helt Sample Type: Mouse Stomach lysates Antibody Dilution: 1.0ug/ml |
|
|