CBFA2T2H Antibody - middle region (ARP37525_P050)

• Product Number: ARP37525_P050
• Name: CBFA2T2H Antibody - middle region (ARP37525_P050)
• Protein Size (# AA): 594 amino acids
• Molecular Weight: 65kDa
• NCBI Gene Id: 12396
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Core-binding factor, runt domain, alpha subunit 2, translocated to, 2 (human)
• Alias Symbols: MTGR, MTGR1, Cbfa2t2h, A430091M07, C330013D05Rik
• Peptide Sequence: Synthetic peptide located within the following region: RRSMAVLRRCQESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Yoshikawa,T., et al., (er) Gene Expr. Patterns (2005) In press
• Description of Target: Mouse Cbfa2t2h associates with mSin3A, N-CoR, and histone deacetylase 3 and that when tethered to DNA, it acts as a transcriptional corepressor.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-Cbfa2t2 (ARP37525_P050) antibody is Catalog # AAP37525 (Previous Catalog # AAPP09631)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse CBFA2T2H
• Uniprot ID: Q6P288
• Protein Name: Protein CBFA2T2
• Protein Accession #: NP_766448
• Purification: Affinity Purified
• Nucleotide Accession #: NM_172860
• Tested Species Reactivity: Mouse
• Gene Symbol: Cbfa2t2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 79%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
• Image 1: Mouse NIH-3T3
  
  WB Suggested Anti-CBFA2T2H Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: NIH/3T3 cell lysate