Product Number |
ARP37470_P050 |
Product Page |
www.avivasysbio.com/nr5a1-antibody-c-terminal-region-arp37470-p050.html |
Name |
Nr5a1 Antibody - C-terminal region (ARP37470_P050) |
Protein Size (# AA) |
462 amino acids |
Molecular Weight |
52kDa |
NCBI Gene Id |
26423 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
nuclear receptor subfamily 5, group A, member 1 |
Alias Symbols |
E, SF, Ad4, ELP, SF-, SF1, SF-1, Ad4BP, ELP-3, Ftzf1, STF-1, Ftz-F1 |
Peptide Sequence |
Synthetic peptide located within the following region: VADQMTLLQNCWSELLVLDHIYRQVQYGKEDSILLVTGQEVELSTVAVQA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Nr5a1 is a transcriptional activator. It seems to be essential for sexual differentiation and formation of the primary steroidogenic tissues. It binds to the Ad4 site found in the promoter region of steroidogenic P450 genes such as CYP11A, CYP11B and CYP21B. Nr5a1 also regulates the AMH/Muellerian inhibiting substance gene as well as the AHCH and STAR genes. 5'-YCAAGGYC-3' and 5'-RRAGGTCA-3' are the consensus sequences for the recognition by NR5A1. The SFPQ-NONO-NR5A1 complex binds to the CYP17 promoter and regulates basal and cAMP-dependent transcriptional avtivity. Transcription repressor of the Moloney leukemia virus long terminal repeat in undifferentiated murine embryonal carcinoma cells. Nr5a1 binds phosphatidylcholine and phospholipids with a phosphatidylinositol (PI) headgroup, in particular phosphatidyl(3,4)bisphosphate, phosphatidyl(3,5)bisphosphate and phosphatidyl(3,4,5)triphosphate. Nr5a1 is activated by the phosphorylation of NR5A1 by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. |
Protein Interactions |
Pitx1; Nfya; Pin1; Sumo1; Ubc; Egr1; Mir383; Ncoa1; Sumo2; Ppargc1a; Lhb; Tbx19; Sox9; Nr0b2; Nr0b1; Ncoa2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Nr5a1 (ARP37470_P050) antibody |
Blocking Peptide |
For anti-Nr5a1 (ARP37470_P050) antibody is Catalog # AAP37470 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Nr5a1 |
Uniprot ID |
P33242 |
Protein Name |
Steroidogenic factor 1 |
Protein Accession # |
NP_620639 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_139051 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Nr5a1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Sheep |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Guinea Pig: 93%; Horse: 86%; Human: 86%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Sheep: 79% |
Image 1 | Mouse Lung
| Host: Rabbit Target Name: Nr5a1 Sample Type: Mouse Lung lysates Antibody Dilution: 1.0ug/ml |
|
|