Nr5a1 Antibody - C-terminal region (ARP37470_P050)

Data Sheet
 
Product Number ARP37470_P050
Product Page www.avivasysbio.com/nr5a1-antibody-c-terminal-region-arp37470-p050.html
Name Nr5a1 Antibody - C-terminal region (ARP37470_P050)
Protein Size (# AA) 462 amino acids
Molecular Weight 52kDa
NCBI Gene Id 26423
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name nuclear receptor subfamily 5, group A, member 1
Alias Symbols E, SF, Ad4, ELP, SF-, SF1, SF-1, Ad4BP, ELP-3, Ftzf1, STF-1, Ftz-F1
Peptide Sequence Synthetic peptide located within the following region: VADQMTLLQNCWSELLVLDHIYRQVQYGKEDSILLVTGQEVELSTVAVQA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Nr5a1 is a transcriptional activator. It seems to be essential for sexual differentiation and formation of the primary steroidogenic tissues. It binds to the Ad4 site found in the promoter region of steroidogenic P450 genes such as CYP11A, CYP11B and CYP21B. Nr5a1 also regulates the AMH/Muellerian inhibiting substance gene as well as the AHCH and STAR genes. 5'-YCAAGGYC-3' and 5'-RRAGGTCA-3' are the consensus sequences for the recognition by NR5A1. The SFPQ-NONO-NR5A1 complex binds to the CYP17 promoter and regulates basal and cAMP-dependent transcriptional avtivity. Transcription repressor of the Moloney leukemia virus long terminal repeat in undifferentiated murine embryonal carcinoma cells. Nr5a1 binds phosphatidylcholine and phospholipids with a phosphatidylinositol (PI) headgroup, in particular phosphatidyl(3,4)bisphosphate, phosphatidyl(3,5)bisphosphate and phosphatidyl(3,4,5)triphosphate. Nr5a1 is activated by the phosphorylation of NR5A1 by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation.
Protein Interactions Pitx1; Nfya; Pin1; Sumo1; Ubc; Egr1; Mir383; Ncoa1; Sumo2; Ppargc1a; Lhb; Tbx19; Sox9; Nr0b2; Nr0b1; Ncoa2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Nr5a1 (ARP37470_P050) antibody
Blocking Peptide For anti-Nr5a1 (ARP37470_P050) antibody is Catalog # AAP37470
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Nr5a1
Uniprot ID P33242
Protein Name Steroidogenic factor 1
Protein Accession # NP_620639
Purification Affinity Purified
Nucleotide Accession # NM_139051
Tested Species Reactivity Mouse
Gene Symbol Nr5a1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Guinea Pig: 93%; Horse: 86%; Human: 86%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Sheep: 79%
Image 1
Mouse Lung
Host: Rabbit
Target Name: Nr5a1
Sample Type: Mouse Lung lysates
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com