Tcfap4 Antibody - middle region (ARP37415_P050)

Data Sheet
 
Product Number ARP37415_P050
Product Page www.avivasysbio.com/tcfap4-antibody-middle-region-arp37415-p050.html
Name Tcfap4 Antibody - middle region (ARP37415_P050)
Protein Size (# AA) 338 amino acids
Molecular Weight 39kDa
NCBI Gene Id 83383
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Transcription factor AP4
Alias Symbols AP, AP-4, Tcfa, Tcfap4, bHLHc4, bHLHc41, AI642933, D930048N17Rik
Peptide Sequence Synthetic peptide located within the following region: AHMYPEKLKVIAQQVQLQQQQEQVRLLHQEKLEREQQHLRTQLLPPPAPT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target TCFap4 belongs to the basic helix-loop-helix (bHLH) family, and is involved in various cell differentiation processes.
Protein Interactions TCF3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Tfap4 (ARP37415_P050) antibody
Blocking Peptide For anti-Tfap4 (ARP37415_P050) antibody is Catalog # AAP37415 (Previous Catalog # AAPP09286)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse Tcfap4
Uniprot ID Q9JIZ5
Protein Name Activator protein 4 EMBL AAF80448.1
Protein Accession # NP_112459
Purification Affinity Purified
Nucleotide Accession # NM_031182
Tested Species Reactivity Mouse
Gene Symbol Tfap4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 79%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Mouse Thymus
WB Suggested Anti-Tcfap4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Mouse Thymus
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com