Product Number |
ARP37415_P050 |
Product Page |
www.avivasysbio.com/tcfap4-antibody-middle-region-arp37415-p050.html |
Name |
Tcfap4 Antibody - middle region (ARP37415_P050) |
Protein Size (# AA) |
338 amino acids |
Molecular Weight |
39kDa |
NCBI Gene Id |
83383 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Transcription factor AP4 |
Alias Symbols |
AP, AP-4, Tcfa, Tcfap4, bHLHc4, bHLHc41, AI642933, D930048N17Rik |
Peptide Sequence |
Synthetic peptide located within the following region: AHMYPEKLKVIAQQVQLQQQQEQVRLLHQEKLEREQQHLRTQLLPPPAPT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
TCFap4 belongs to the basic helix-loop-helix (bHLH) family, and is involved in various cell differentiation processes. |
Protein Interactions |
TCF3; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Tfap4 (ARP37415_P050) antibody |
Blocking Peptide |
For anti-Tfap4 (ARP37415_P050) antibody is Catalog # AAP37415 (Previous Catalog # AAPP09286) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse Tcfap4 |
Uniprot ID |
Q9JIZ5 |
Protein Name |
Activator protein 4 EMBL AAF80448.1 |
Protein Accession # |
NP_112459 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_031182 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Tfap4 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 79%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Mouse Thymus
| WB Suggested Anti-Tcfap4 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:12500 Positive Control: Mouse Thymus |
|
|