MEF2C Antibody - N-terminal region (ARP37342_T100)

• Product Number: ARP37342_T100
• Name: MEF2C Antibody - N-terminal region (ARP37342_T100)
• Protein Size (# AA): 432 amino acids
• Molecular Weight: 48kDa
• NCBI Gene Id: 17260
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Myocyte enhancer factor 2C
• Description:
  View product citations for MEF2C Antibody - N-terminal region (ARP37342_T100) on CiteAb
• Alias Symbols: Mef2, AV011172, 5430401D19Rik, 9930028G15Rik
• Peptide Sequence: Synthetic peptide located within the following region: SRTNSDIVEALNKKENKGSESPDPDSSYALTPRTEEKYKKINEEFDNMIK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Shen,H., et al., (2006) Genes Dev. 20 (6), 675-688
• Description of Target: MEF2C is a transcription regulator of slow fiber
• Protein Interactions: Vgll2; Hdac4; Nkx2-5; Hdac5; Phb2; KDM1A; Carm1; Ifrd1; Ncoa3; Ncoa2; Foxh1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MEF2C (ARP37342_T100) antibody is Catalog # AAP37342 (Previous Catalog # AAPP09440)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse MEF2C
• Uniprot ID: Q8CFN5-4
• Protein Name: Myocyte-specific enhancer factor 2C
• Publications:

  Escher, P., Schorderet, D. F. & Cottet, S. Altered expression of the transcription factor Mef2c during retinal degeneration in Rpe65-/- mice. Invest. Ophthalmol. Vis. Sci. 52, 5933-40 (2011). 21715356

  Inagawa, K. et al. Induction of cardiomyocyte-like cells in infarct hearts by gene transfer of Gata4, Mef2c, and Tbx5. Circ. Res. 111, 1147-56 (2012). 22931955

  Law, S. K. et al. Regulation of multiple transcription factors by reactive oxygen species and effects of pro-inflammatory cytokines released during myocardial infarction on cardiac differentiation of embryonic stem cells. Int. J. Cardiol. 168, 3458-72 (2013). 23706318

  Leschik, J., Stefanovic, S., Brinon, B. & Pucéat, M. Cardiac commitment of primate embryonic stem cells. Nat. Protoc. 3, 1381-7 (2008). 18772864

  Lombardi, R. et al. Genetic fate mapping identifies second heart field progenitor cells as a source of adipocytes in arrhythmogenic right ventricular cardiomyopathy. Circ. Res. 104, 1076-84 (2009). 19359597

  Targeting the histone demethylase LSD1 prevents cardiomyopathy in a mouse model of laminopathy. J Clin Invest. 131 (2021). 33393499

  Tennis, M. A. et al. Prostacyclin inhibits non-small cell lung cancer growth by a frizzled 9-dependent pathway that is blocked by secreted frizzled-related protein 1. Neoplasia 12, 244-53 (2010). 20335662

• Protein Accession #: NP_079558
• Purification: Protein A purified
• Nucleotide Accession #: NM_025282
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: MEF2C
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
• Image 1: Human Fetal Brain
  
  Host: Rabbit
  Target Name: MEF2C
  Sample Tissue: Human Fetal Brain
  Antibody Dilution: 1.0ug/ml