Ddx20 Antibody - C-terminal region (ARP37239_P050)

• Product Number: ARP37239_P050
• Name: Ddx20 Antibody - C-terminal region (ARP37239_P050)
• Protein Size (# AA): 825 amino acids
• Molecular Weight: 92kDa
• NCBI Gene Id: 53975
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 20
• Alias Symbols: GEMI, dp10, dp103, GEMIN3
• Peptide Sequence: Synthetic peptide located within the following region: RRPIPARSRLVMLPKVETEAPGLVRSHGEQGQMPENMQVSQFKMVNYSYD
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The function of Ddx20 remains unknown.
• Protein Interactions: Etv3; Ncor2; Sin3a; Ncor1; Hdac2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-Ddx20 (ARP37239_P050) antibody is Catalog # AAP37239 (Previous Catalog # AAPS06208)
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of mouse Ddx20
• Uniprot ID: Q059Z6
• Protein Name: Probable ATP-dependent RNA helicase DDX20
• Protein Accession #: NP_059093
• Purification: Affinity Purified
• Nucleotide Accession #: NM_017397
• Tested Species Reactivity: Mouse
• Gene Symbol: Ddx20
• Predicted Species Reactivity: Mouse, Rat
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Mouse: 100%; Rat: 86%
• Image 1: Mouse NIH-3T3
  
  WB Suggested Anti-Ddx20 Antibody Titration: 0.2-1 ug/ml
  Positive Control: NIH/3T3 cell lysate
• Image 2: Mouse Gut
  
  Sample Type:
  Mouse Gut Tissue TgWnt1-Cre/+ Ednrbflex3/+ Rosa26YFPStop/YFPStop
  Primary Antibody Dilution:
  1:50
  Secondary Antibody:
  Goat anti-rabbit-cy3
  Secondary Antibody Dilution:
  1:1500
  Color/Signal Descriptions:
  Ddx20: Green Neural crest cells:: Red
  Gene Name:
  Ddx20
  Submitted by:
  Anonymous