| Product Number |
ARP37218_P050 |
| Product Page |
www.avivasysbio.com/aip-antibody-middle-region-arp37218-p050.html |
| Name |
Aip Antibody - middle region (ARP37218_P050) |
| Protein Size (# AA) |
330 amino acids |
| Molecular Weight |
37kDa |
| NCBI Gene Id |
11632 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Aryl-hydrocarbon receptor-interacting protein |
| Alias Symbols |
A, Xa, Ara9, Xap2, Fkbp1, Fkbp16, AA408703, AW476050, D19Bwg1412e |
| Peptide Sequence |
Synthetic peptide located within the following region: VAKSLRNIAEGKDPLEGQRHCCGIAQMHEHSSLGHADLDALQQNPQPLIF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Aip may play a positive role in AHR-mediated (aromatic hydrocarbon receptor) signaling, possibly by influencing its receptivity for ligand and/or its nuclear targeting. |
| Protein Interactions |
Ahr; Hsp90ab1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Aip (ARP37218_P050) antibody |
| Blocking Peptide |
For anti-Aip (ARP37218_P050) antibody is Catalog # AAP37218 (Previous Catalog # AAPP09421) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
O08915 |
| Protein Name |
AH receptor-interacting protein |
| Protein Accession # |
NP_057875 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_016666 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Aip |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rat: 100%; Zebrafish: 86% |
| Image 1 | Mouse SP2/0
 | WB Suggested Anti-Aip Antibody Titration: 0.2-1 ug/ml
Positive Control: SP2/0 cell lysate |
|
|
