| Product Number |
ARP37048_P050 |
| Product Page |
www.avivasysbio.com/foxf1a-antibody-middle-region-arp37048-p050.html |
| Name |
Foxf1a Antibody - middle region (ARP37048_P050) |
| Protein Size (# AA) |
353 amino acids |
| Molecular Weight |
38kDa |
| NCBI Gene Id |
15227 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Forkhead box F1a |
| Alias Symbols |
FREA, Foxf, Hfh8, Freac, HFH-8, FREAC1, Foxf1a, Freac-1, AI450827 |
| Peptide Sequence |
Synthetic peptide located within the following region: GCGGSAAGEYPHHDSSVPASPLLPAGAGGVMEPHAVYSSSAAAWPPAASA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Foxf1 (ARP37048_P050) antibody |
| Blocking Peptide |
For anti-Foxf1 (ARP37048_P050) antibody is Catalog # AAP37048 (Previous Catalog # AAPP09244) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse Foxf1a |
| Uniprot ID |
Q61080 |
| Protein Name |
Forkhead box protein F1 |
| Protein Accession # |
NP_034556 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_010426 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Foxf1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 77% |
| Image 1 | Mouse
 | Sample Type: Mouse E 18.5 Gut
Dilution: 1:1000 |
| | Image 2 | Mouse Heart
 | WB Suggested Anti-Foxf1a Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Mouse Heart |
|
|
