Product Number |
ARP37039_P050 |
Product Page |
www.avivasysbio.com/esr2-antibody-n-terminal-region-arp37039-p050.html |
Name |
Esr2 Antibody - N-terminal region (ARP37039_P050) |
Protein Size (# AA) |
567 amino acids |
Molecular Weight |
63kDa |
NCBI Gene Id |
13983 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Estrogen receptor 2 (beta) |
Description |
|
Alias Symbols |
Est, ERbe, ER[b], Estrb, ERbeta |
Peptide Sequence |
Synthetic peptide located within the following region: IPSSYVESRHEYSAMTFYSPAVMNYSVPSSTGNLEGGPVRQTASPNVLWP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of this protein remains unknown. |
Protein Interactions |
Apc; Rbm39; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Esr2 (ARP37039_P050) antibody |
Blocking Peptide |
For anti-Esr2 (ARP37039_P050) antibody is Catalog # AAP37039 (Previous Catalog # AAPP09237) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
Uniprot ID |
Q8BG65 |
Protein Name |
Estrogen receptor beta |
Protein Accession # |
NP_997590 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_207707 |
Tested Species Reactivity |
Human, Mouse |
Gene Symbol |
Esr2 |
Predicted Species Reactivity |
Mouse, Rat |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Mouse: 100%; Rat: 83% |
Image 1 | Mouse Small Intestine
| WB Suggested Anti-Esr2 Antibody Titration: 0.2-1 ug/ml Positive Control: Mouse Small Intestine |
| Image 2 | Human NT-2, Mouse WT brain
| Lanes: 1. Human NT-2 cells (60ug) lysate 2. Mouse WT brain extract (80ug) Primary Antibody Dilution: 2ug/ml Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience Secondary Antibody Dilution: 1: 20,000 Gene Name: Esr2 Submitted by: Dr. Yuzhi Chen, University of Arkansas for Medical Science
|
| Image 3 | Mouse Skeletal Muscle
| Host: Mouse Target Name: ESR2 Sample Tissue: Mouse Skeletal Muscle Antibody Dilution: 1ug/ml |
| Image 4 | Mouse Skeletal Muscle
| Host: Rabbit Target Name: ESR2 Sample Tissue: Mouse Skeletal Muscle Antibody Dilution: 1ug/ml |
|
|