Esr2 Antibody - N-terminal region (ARP37039_P050)

Data Sheet
 
Product Number ARP37039_P050
Product Page www.avivasysbio.com/esr2-antibody-n-terminal-region-arp37039-p050.html
Name Esr2 Antibody - N-terminal region (ARP37039_P050)
Protein Size (# AA) 567 amino acids
Molecular Weight 63kDa
NCBI Gene Id 13983
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Estrogen receptor 2 (beta)
Description
Alias Symbols Est, ERbe, ER[b], Estrb, ERbeta
Peptide Sequence Synthetic peptide located within the following region: IPSSYVESRHEYSAMTFYSPAVMNYSVPSSTGNLEGGPVRQTASPNVLWP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of this protein remains unknown.
Protein Interactions Apc; Rbm39;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Esr2 (ARP37039_P050) antibody
Blocking Peptide For anti-Esr2 (ARP37039_P050) antibody is Catalog # AAP37039 (Previous Catalog # AAPP09237)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Uniprot ID Q8BG65
Protein Name Estrogen receptor beta
Protein Accession # NP_997590
Purification Affinity Purified
Nucleotide Accession # NM_207707
Tested Species Reactivity Human, Mouse
Gene Symbol Esr2
Predicted Species Reactivity Mouse, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Mouse: 100%; Rat: 83%
Image 1
Mouse Small Intestine
WB Suggested Anti-Esr2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Mouse Small Intestine
Image 2
Human NT-2, Mouse WT brain
Lanes:
1. Human NT-2 cells (60ug) lysate 2. Mouse WT brain extract (80ug)
Primary Antibody Dilution:
2ug/ml
Secondary Antibody:
IRDye 800CW goat anti-rabbit from Li-COR Bioscience
Secondary Antibody Dilution:
1: 20,000
Gene Name:
Esr2
Submitted by:
Dr. Yuzhi Chen, University of Arkansas for Medical Science
Image 3
Mouse Skeletal Muscle
Host: Mouse
Target Name: ESR2
Sample Tissue: Mouse Skeletal Muscle
Antibody Dilution: 1ug/ml
Image 4
Mouse Skeletal Muscle
Host: Rabbit
Target Name: ESR2
Sample Tissue: Mouse Skeletal Muscle
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com