| Product Number |
ARP37033_P050 |
| Product Page |
www.avivasysbio.com/dnmt1-antibody-n-terminal-region-arp37033-p050.html |
| Name |
Dnmt1 Antibody - N-terminal region (ARP37033_P050) |
| Protein Size (# AA) |
1619 amino acids |
| Molecular Weight |
183kDa |
| NCBI Gene Id |
13433 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
DNA methyltransferase (cytosine-5) 1 |
| Description |
|
| Alias Symbols |
MTa, Dnmt, MCMT, Met1, Cxxc9, MTase, Met-1, Dnmt1o, MommeD, m.MmuI, MommeD2 |
| Peptide Sequence |
Synthetic peptide located within the following region: SSVATRRTTRQTTITAHFTKGPTKRKPKEESEEGNSAESAAEERDQDKKR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Dnmt1 methylates CpG residues.Dnmt1 preferentially methylates hemimethylated DNA. Dnmt1 associates with DNA replication sites in S phase maintaining the methylation pattern in the newly synthesized strand, that is essential for epigenetic inheritance.Dnmt1 associates with chromatin during G2 and M phases to maintain DNA methylation independently of replication. It is responsible for maintaining methylation patterns established in development. DNA methylation is coordinated with methylation of histones.Dnmt1 mediates transcriptional repression by direct binding to HDAC2. In association with DNMT3B and via the recruitment of CTCFL/BORIS, Dnmt1 is involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9. |
| Protein Interactions |
Uhrf1; Parp1; Eed; hist1h3g; DSK2; VPS9; Kat5; Ubc; Atm; NUB1; UBQLN1; SQSTM1; PSMD4; NBR1; RAD23B; Hesx1; Ezh2; Zbtb16; Cul3; Cdh1; Dmap1; Tcf3; hist1h4a; hist1h2bj; hist2h2ab; Dnmt1; Kcnq1ot1; Pla2g2a; Apc; Tox3; Rela; HDAC1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Dnmt1 (ARP37033_P050) antibody |
| Blocking Peptide |
For anti-Dnmt1 (ARP37033_P050) antibody is Catalog # AAP37033 (Previous Catalog # AAPP09231) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse Dnmt1 |
| Uniprot ID |
P13864 |
| Protein Name |
DNA (cytosine-5)-methyltransferase 1 |
| Protein Accession # |
NP_034196 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_010066 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Dnmt1 |
| Predicted Species Reactivity |
Mouse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Mouse: 100% |
| Image 1 | Mouse Lung
 | WB Suggested Anti-Dnmt1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Mouse Lung |
|
| Image 2 | mouse ES
 | Researcher:Austin J. Cooney, Baylor College of Medicine
Application:Western blotting
Species+tissue/cell type: Lane 1: 15ug WT mouse ES lysate Lane 2: 15ug DNMT1 KO mouse ES lysate
Primary antibody dilution:1:1000
Secondary antibody:Goat anti-rabbit-HRP
Secondary antibody dilution:1:2500 |
|
| Image 3 | mouse mesenchymal stem
 | Researcher: Anonymous
Application: Western Blotting
Species+tissue/cell type: Lane 1: 20ug mouse mesenchymal stem cell lysate
Primary antibody dilution: 1:2000
Secondary antibody: Anti-rabbit-HRP
Secondary antibody dilution: 1:10,000 |
|
