SMYD1 Antibody - N-terminal region (ARP37022_P050)

• Product Number: ARP37022_P050
• Name: SMYD1 Antibody - N-terminal region (ARP37022_P050)
• Protein Size (# AA): 472 amino acids
• Molecular Weight: 52kDa
• NCBI Gene Id: 12180
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: SET and MYND domain containing 1
• Alias Symbols: B, Bop, C78565, Zmynd18, 4632404M21Rik
• Peptide Sequence: Synthetic peptide located within the following region: MENVEVFTSEGKGRGLKATKEFWAADVIFAERAYSAVVFDSLINFVCHTC
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Phan,D., et al., (2005) Development 132 (11), 2669-2678
• Description of Target: SMYD1 is a histone methyltransferases and plays a critical role in myofibril organization during myofiber maturation
• Protein Interactions: Trp53; Naca; Hdac1; Hdac3; Hdac2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SMYD1 (ARP37022_P050) antibody is Catalog # AAP37022 (Previous Catalog # AAPP09220)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse SMYD1
• Uniprot ID: P97443-2
• Protein Name: SET and MYND domain-containing protein 1
• Protein Accession #: NP_033892
• Purification: Affinity Purified
• Nucleotide Accession #: NM_009762
• Tested Species Reactivity: Mouse
• Gene Symbol: SMYD1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Mouse NIH-3T3
  
  WB Suggested Anti-SMYD1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: NIH/3T3 cell lysate