ATF4 Antibody - N-terminal region (ARP37017_P050)

• Product Number: ARP37017_P050
• Name: ATF4 Antibody - N-terminal region (ARP37017_P050)
• Protein Size (# AA): 381 amino acids
• Molecular Weight: 42kDa
• NCBI Gene Id: 11911
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Activating transcription factor 4
• Description:
  View product citations for ATF4 Antibody - N-terminal region (ARP37017_P050) on CiteAb
• Alias Symbols: Atf-, C/AT, CREB, Atf-4, C/ATF, CREB2, CREB-2, TAXREB, TAXREB67
• Peptide Sequence: Synthetic peptide located within the following region: MALFTKSSSSVAVTDKDTFELSTFLESSKAPQHDRDELPEQRSVGGGLDD
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Smith,J.A., et al., (2006) J. Virol. 80 (4), 2019-2033
• Description of Target: Atf4 binds to asymmetric cAMP response elements (CRE) as a heterodimer and to palindromic CRE's as a homodimer.
• Protein Interactions: Egln3; Ubc; Hif1a; Satb2; Fam175b; Trib3; Gabbr2; Gabbr1; Jun; Fos; Dapk3; Rps6ka3; Tnfsf11; Prkaca;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ATF4 (ARP37017_P050) antibody is Catalog # AAP37017 (Previous Catalog # AAPP09926)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse ATF4
• Uniprot ID: Q61328
• Protein Name: Activating transcriptionn factor 4 EMBL CAA43723.1
• Publications:

  Alger, H. M., Rayavarapu, S. & Nagaraju, K. Measurement of activation of the endoplasmic reticulum stress response in autoimmune myositis. Methods Enzymol. 489, 207-25 (2011). 21266232

  Cross-Talk Between FSH and Endoplasmic Reticulum Stress: A Mutually Suppressive Relationship. Reprod Sci. 23, 352-64 (2016). 26342052

  Deficiency of VCP-Interacting Membrane Selenoprotein (VIMP) Leads to G1 Cell Cycle Arrest and Cell Death in MIN6 Insulinoma Cells. Cell Physiol Biochem. 51, 2185-2197 (2018). 30537728

  Drivas, T. G., Holzbaur, E. L. F. & Bennett, J. Disruption of CEP290 microtubule/membrane-binding domains causes retinal degeneration. J. Clin. Invest. 123, 4525-39 (2013). 24051377

  Glutathione S-Transferase P-Mediated Protein S-Glutathionylation of Resident Endoplasmic Reticulum Proteins Influences Sensitivity to Drug-Induced Unfolded Protein Response. Antioxid. Redox Signal. 26, 247-261 (2017). 26838680

  IER3IP1 deficiency leads to increased β-cell death and decreased β-cell proliferation. Oncotarget. 8, 56768-56779 (2017). 28915629

  Mast Cells Induce Blood Brain Barrier Damage in SCD by Causing Endoplasmic Reticulum Stress in the Endothelium. Front Cell Neurosci. 13, 56 (2019). 30837844

  Methods for monitoring endoplasmic reticulum stress and the unfolded protein response. Int J Cell Biol. 2010, 830307 (2010). 20169136

  Oligodendrocyte Death in Pelizaeus-Merzbacher Disease Is Rescued by Iron Chelation. Cell Stem Cell. 25, 531-541.e6 (2019). 31585094

  Schneeberger, M. et al. Mitofusin 2 in POMC Neurons Connects ER Stress with Leptin Resistance and Energy Imbalance. Cell 155, 172-87 (2013). 24074867

  The integrated stress response in hypoxia-induced diffuse white matter injury. J Neurosci. , (2017). 28720571

• Protein Accession #: NP_033846
• Purification: Affinity Purified
• Nucleotide Accession #: NM_009716
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: ATF4
• Predicted Species Reactivity: Mouse
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Mouse: 100%
• Image 1: Mouse NIH-3T3
  
  WB Suggested Anti-ATF4 Antibody Titration: 0.125ug/ml
  ELISA Titer: 1:62500
  Positive Control: NIH/3T3 cell lysate
• Image 2: Human
  
  Immunohistochemistry with Human Braun, cerebellum tissue at an antibody concentration of 5.0ug/ml using anti-ATF4 antibody (ARP37017_P050)
• Image 3: Mouse Brain
  
  Host: Mouse
  Target Name: ATF4
  Sample Tissue: Mouse Brain
  Antibody Dilution: 1ug/ml
• Image 4: Mouse Brain
  
  Host: Rabbit
  Target Name: ATF4
  Sample Tissue: Mouse Brain
  Antibody Dilution: 1ug/ml
• Image 5: Human Bone Marrow
  
  Rabbit Anti-ATF4 Antibody
  Catalog Number: ARP37017_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Bone Marrow Tissue
  Observed Staining: Cytoplasm, Nucleus
  Primary Antibody Concentration: 1:600
  Other Working Concentrations: N/A
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec
• Image 6: Mouse Skeletal Muscle
  
  Host: Rabbit
  Target Name: Atf4
  Sample Tissue: Mouse Skeletal Muscle
  Antibody Dilution: 3ug/ml