Hoxb13 Antibody - N-terminal region (ARP36889_P050)

• Product Number: ARP36889_P050
• Name: Hoxb13 Antibody - N-terminal region (ARP36889_P050)
• Protein Size (# AA): 286 amino acids
• Molecular Weight: 31kDa
• NCBI Gene Id: 15408
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Homeobox B13
• Alias Symbols: -
• Peptide Sequence: Synthetic peptide located within the following region: MEPGNYATLDGAKDIEGLLGAGGGRNLVSHSSPLASHPAAPTLMPTVNYA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: Hoxb13 is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
• Protein Interactions: Otx2; Dlx5; Dlx1; Alx4; Meis1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-Hoxb13 (ARP36889_P050) antibody is Catalog # AAP36889 (Previous Catalog # AAPY00640)
• Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of mouse Hoxb13
• Uniprot ID: P70321
• Protein Name: Homeobox protein Hox-B13
• Publications:

  Machida, M. et al. Reduction of ribosome biogenesis with activation of the mTOR pathway in denervated atrophic muscle. J. Cell. Physiol. 227, 1569-76 (2012). 21529712

• Protein Accession #: NP_032293
• Purification: Affinity Purified
• Nucleotide Accession #: NM_008267
• Tested Species Reactivity: Mouse
• Gene Symbol: Hoxb13
• Predicted Species Reactivity: Human, Mouse, Rat, Guinea Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Guinea Pig: 85%; Human: 79%; Mouse: 100%; Rabbit: 79%; Rat: 93%
• Image 1: Mouse Thymus
  
  WB Suggested Anti-Hoxb13 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Mouse Thymus