| Product Number |
ARP36845_P050 |
| Product Page |
www.avivasysbio.com/elf1-antibody-n-terminal-region-arp36845-p050.html |
| Name |
ELF1 Antibody - N-terminal region (ARP36845_P050) |
| Protein Size (# AA) |
612 amino acids |
| Molecular Weight |
67kDa |
| NCBI Gene Id |
13709 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
E74-like factor 1 |
| Alias Symbols |
p70, Elf-, Sts1, Elf-1, mElf-1 |
| Peptide Sequence |
Synthetic peptide located within the following region: DDIVAPITHVSVTLDGIPEVMETQQVQETNADSPGASSPEQRKRKKGRKT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Geng,Y., et al., (2005) J. Immunol. 175 (2), 1022-1029 |
| Description of Target |
Elf1 belongs to the ETS family. Elf1 is a transcription factor that activates the LYN and BLK promoters. Elf1 may interact with other transcription factors in order to regulate specific genes. Elf1 can bind to the underphosphorylated form of RB. |
| Protein Interactions |
Ephb4; Dmd; Jak2; Foxp3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ELF1 (ARP36845_P050) antibody |
| Blocking Peptide |
For anti-ELF1 (ARP36845_P050) antibody is Catalog # AAP36845 (Previous Catalog # AAPP09918) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse ELF1 |
| Uniprot ID |
Q60775 |
| Protein Name |
ETS-related transcription factor Elf-1 |
| Protein Accession # |
NP_031946 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_007920 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
ELF1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 80%; Horse: 80%; Human: 87%; Mouse: 100%; Rabbit: 87%; Rat: 88% |
| Image 1 | Human Hela
 | WB Suggested Anti-ELF1 antibody Titration: 1 ug/mL
Sample Type: Human Hela |
|
| Image 2 | Human MCF7
 | WB Suggested Anti-ELF1 antibody Titration: 1 ug/mL
Sample Type: Human MCF7 |
|
| Image 3 | Mouse SP2/0
 | WB Suggested Anti-ELF1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: SP2/0 cell lysate |
|
