| Product Number |
ARP36843_P050 |
| Product Page |
www.avivasysbio.com/ehf-antibody-middle-region-arp36843-p050.html |
| Name |
Ehf Antibody - middle region (ARP36843_P050) |
| Protein Size (# AA) |
300 amino acids |
| Molecular Weight |
35kDa |
| NCBI Gene Id |
13661 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Ets homologous factor |
| Alias Symbols |
AU019492, 9030625L19Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: LFQSAHNVIVKTEQTDPSIMNTWKEENYLYDPSYGSTVDLLDSKTFCRAQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Ehf is a transcriptional activator that may play a role in regulating epithelial cell differentiation and proliferation.Ehf may act as a repressor for a specific subset of ETS/AP-1-responsive genes, and as a modulator of the nuclear response to mitogen-activated protein kinase signaling cascades.Ehf binds to DNA sequences containing the consensus nucleotide core sequence GGAA.Ehf is involved in regulation of TNFRSF10B/DR5 expression through Ets-binding sequences on the TNFRSF10B/DR5 promoter. |
| Protein Interactions |
Nfkbiz; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Ehf (ARP36843_P050) antibody |
| Blocking Peptide |
For anti-Ehf (ARP36843_P050) antibody is Catalog # AAP36843 (Previous Catalog # AAPP09916) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
O70273 |
| Protein Name |
ETS homologous factor |
| Protein Accession # |
NP_031940 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_007914 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
Ehf |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 79%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Sheep: 86% |
| Image 1 | Human Breast
 | Immunohistochemistry with Breast tissue at an antibody concentration of 5ug/ml using anti-Ehf antibody (ARP36843_P050) |
| | Image 2 | Mouse Brain
 | WB Suggested Anti-Ehf Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Mouse Brain |
|
|
