| Product Number |
ARP36686_T100 |
| Product Page |
www.avivasysbio.com/anxa4-antibody-n-terminal-region-arp36686-t100.html |
| Name |
ANXA4 Antibody - N-terminal region (ARP36686_T100) |
| Protein Size (# AA) |
321 amino acids |
| Molecular Weight |
36 kDa |
| NCBI Gene Id |
307 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Annexin A4 |
| Alias Symbols |
ANX4, P32.5, PIG28, PP4-X, ZAP36, PAP-II, HEL-S-274 |
| Peptide Sequence |
Synthetic peptide located within the following region: GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Zimmermann,U., et al., (2004) Cancer Lett. 209 (1), 111-118 |
| Description of Target |
Annexin A4 (ANXA4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANXA4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANXA4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANXA4 is almost exclusively expressed in epithelial cells. |
| Protein Interactions |
PADI4; UBC; EZH2; DNAJB11; MPST; ANXA7; ANXA3; ANXA1; TINF2; POT1; SUMO2; NMT2; SMPD1; Cdk1; UCHL5; H2AFX; NFKB1; GP2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
| Relative Expression (Western Blot) |
 |
|
| Datasheets/Manuals |
Printable datasheet for anti-ANXA4 (ARP36686_T100) antibody |
| Blocking Peptide |
For anti-ANXA4 (ARP36686_T100) antibody is Catalog # AAP36686 (Previous Catalog # AAPP08113) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA4 |
| Uniprot ID |
Q6LES2 |
| Protein Name |
Annexin RuleBase RU003540 |
| Publications |
de la Cuesta, F. et al. A proteomic focus on the alterations occurring at the human atherosclerotic coronary intima. Mol. Cell. Proteomics 10, M110.003517 (2011). 21248247
Staquicini, F. I. et al. Vascular ligand-receptor mapping by direct combinatorial selection in cancer patients. Proc. Natl. Acad. Sci. U. S. A. 108, 18637-42 (2011). 22049339 |
| Protein Accession # |
NP_001144 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_001153 |
| Tested Species Reactivity |
Human, Rat |
| Gene Symbol |
ANXA4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
| Image 1 | Human Fetal Liver
 | Host: Rabbit
Target Name: ANXA4
Sample Tissue: Human Fetal Liver
Antibody Dilution: 1.0ug/ml |
|
| Image 2 | Human stomach, 293T
 | Host: Rabbit
Target: ANXA4
Positive control (+): Human stomach (ST)
Negative control (-): 293T (2T)
Antibody concentration: 1ug/ml |
|
| Image 3 | Human Intestine
 | Human Intestine |
|
| Image 4 |
 | 25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. The protein can be modified by acetylation and phosphorylation. |
|
