Product Number |
ARP36658_P050 |
Product Page |
www.avivasysbio.com/mcm8-antibody-n-terminal-region-arp36658-p050.html |
Name |
MCM8 Antibody - N-terminal region (ARP36658_P050) |
Protein Size (# AA) |
840 amino acids |
Molecular Weight |
94kDa |
NCBI Gene Id |
84515 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Minichromosome maintenance complex component 8 |
Alias Symbols |
POF10, C20orf154, dJ967N21.5 |
Peptide Sequence |
Synthetic peptide located within the following region: ELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPH |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Clarke,C.A. Biochem. J. 388 (PT 2), 705-712 (2005) |
Description of Target |
This protein is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the MCM proteins. This protein has been shown to co-immunoprecipitate with MCM4, 6 and 7, which suggests that it may interact with other MCM proteins and play a role in DNA replication.The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the MCM proteins. This protein has been shown to co-immunoprecipitate with MCM4, 6 and 7, which suggests that it may interact with other MCM proteins and play a role in DNA replication. Alternatively spliced transcript variants encoding distinct isoforms have been described. |
Protein Interactions |
MCMBP; MCM4; MCM6; MCM7; ORC2; CDC6; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-MCM8 (ARP36658_P050) antibody |
Blocking Peptide |
For anti-MCM8 (ARP36658_P050) antibody is Catalog # AAP36658 (Previous Catalog # AAPP07915) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human MCM8 |
Uniprot ID |
Q9UJA3 |
Protein Name |
DNA helicase MCM8 |
Protein Accession # |
NP_115874 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_032485 |
Tested Species Reactivity |
Human |
Gene Symbol |
MCM8 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 91%; Rat: 100%; Zebrafish: 85% |
Image 1 | Human HepG2
| WB Suggested Anti-MCM8 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate |
|
Image 2 | siRNA transfection
| MCM8 WB Sample: siRNA Mock and siRNA MCM8 Dilution 1:1000 |
|