MCM8 Antibody - N-terminal region (ARP36658_P050)

Data Sheet
 
Product Number ARP36658_P050
Product Page www.avivasysbio.com/mcm8-antibody-n-terminal-region-arp36658-p050.html
Name MCM8 Antibody - N-terminal region (ARP36658_P050)
Protein Size (# AA) 840 amino acids
Molecular Weight 94kDa
NCBI Gene Id 84515
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Minichromosome maintenance complex component 8
Alias Symbols POF10, C20orf154, dJ967N21.5
Peptide Sequence Synthetic peptide located within the following region: ELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Clarke,C.A. Biochem. J. 388 (PT 2), 705-712 (2005)
Description of Target This protein is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the MCM proteins. This protein has been shown to co-immunoprecipitate with MCM4, 6 and 7, which suggests that it may interact with other MCM proteins and play a role in DNA replication.The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the MCM proteins. This protein has been shown to co-immunoprecipitate with MCM4, 6 and 7, which suggests that it may interact with other MCM proteins and play a role in DNA replication. Alternatively spliced transcript variants encoding distinct isoforms have been described.
Protein Interactions MCMBP; MCM4; MCM6; MCM7; ORC2; CDC6;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MCM8 (ARP36658_P050) antibody
Blocking Peptide For anti-MCM8 (ARP36658_P050) antibody is Catalog # AAP36658 (Previous Catalog # AAPP07915)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MCM8
Uniprot ID Q9UJA3
Protein Name DNA helicase MCM8
Protein Accession # NP_115874
Purification Affinity Purified
Nucleotide Accession # NM_032485
Tested Species Reactivity Human
Gene Symbol MCM8
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 91%; Rat: 100%; Zebrafish: 85%
Image 1
Human HepG2
WB Suggested Anti-MCM8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Image 2
siRNA transfection
MCM8 WB Sample: siRNA Mock and siRNA MCM8 Dilution 1:1000
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com