Product Number |
ARP36639_P050 |
Product Page |
www.avivasysbio.com/gjc3-antibody-middle-region-arp36639-p050.html |
Name |
GJC3 Antibody - middle region (ARP36639_P050) |
Protein Size (# AA) |
279 amino acids |
Molecular Weight |
31kDa |
NCBI Gene Id |
349149 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Gap junction protein, gamma 3, 30.2kDa |
Alias Symbols |
CX29, GJE1, CX30.2, CX31.3 |
Peptide Sequence |
Synthetic peptide located within the following region: WHWELSGKGKEEETLIQGREGNTDVPGAGSLRLLWAYVAQLGARLVLEGAA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene encodes a gap junction protein. The encoded protein, also known as a connexin, plays a role in formation of gap junctions, which provide direct connections between neighboring cells. Mutations in this gene have been reported to be associated with nonsyndromic hearing loss. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-GJC3 (ARP36639_P050) antibody |
Blocking Peptide |
For anti-GJC3 (ARP36639_P050) antibody is Catalog # AAP36639 (Previous Catalog # AAPS06303) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GJC3 |
Uniprot ID |
Q8NFK1 |
Protein Name |
Gap junction gamma-3 protein |
Protein Accession # |
NP_853516 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_181538 |
Tested Species Reactivity |
Human |
Gene Symbol |
GJC3 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human PANC1
| WB Suggested Anti-GJC3 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: PANC1 cell lysate |
|
|