GJC3 Antibody - middle region (ARP36639_P050)

Data Sheet
 
Product Number ARP36639_P050
Product Page www.avivasysbio.com/gjc3-antibody-middle-region-arp36639-p050.html
Name GJC3 Antibody - middle region (ARP36639_P050)
Protein Size (# AA) 279 amino acids
Molecular Weight 31kDa
NCBI Gene Id 349149
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Gap junction protein, gamma 3, 30.2kDa
Alias Symbols CX29, GJE1, CX30.2, CX31.3
Peptide Sequence Synthetic peptide located within the following region: WHWELSGKGKEEETLIQGREGNTDVPGAGSLRLLWAYVAQLGARLVLEGAA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a gap junction protein. The encoded protein, also known as a connexin, plays a role in formation of gap junctions, which provide direct connections between neighboring cells. Mutations in this gene have been reported to be associated with nonsyndromic hearing loss.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GJC3 (ARP36639_P050) antibody
Blocking Peptide For anti-GJC3 (ARP36639_P050) antibody is Catalog # AAP36639 (Previous Catalog # AAPS06303)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GJC3
Uniprot ID Q8NFK1
Protein Name Gap junction gamma-3 protein
Protein Accession # NP_853516
Purification Affinity Purified
Nucleotide Accession # NM_181538
Tested Species Reactivity Human
Gene Symbol GJC3
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human PANC1
WB Suggested Anti-GJC3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: PANC1 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com