| Product Number |
ARP36623_P050 |
| Product Page |
www.avivasysbio.com/gjd2-antibody-middle-region-arp36623-p050.html |
| Name |
GJD2 Antibody - middle region (ARP36623_P050) |
| Protein Size (# AA) |
321 amino acids |
| Molecular Weight |
36 kDa |
| NCBI Gene Id |
57369 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Gap junction protein, delta 2, 36kDa |
| Alias Symbols |
CX36, GJA9 |
| Peptide Sequence |
Synthetic peptide located within the following region: ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Charpantier,E., (2007) Diabetologia 50 (11), 2332-2341 |
| Description of Target |
GJD2 is a member of the connexin gene family that is expressed predominantly in mammalian neurons. Connexins associate in groups of 6 and are organized radially around a central pore to form connexons. Each gap junction intercellular channel is formed by the conjunction of 2 connexons.This gene is a member of the connexin gene family that is expressed predominantly in mammalian neurons. Connexins associate in groups of 6 and are organized radially around a central pore to form connexons. Each gap junction intercellular channel is formed by the conjunction of 2 connexons. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
| Relative Expression (Western Blot) |
 |
|
| Datasheets/Manuals |
Printable datasheet for anti-GJD2 (ARP36623_P050) antibody |
| Blocking Peptide |
For anti-GJD2 (ARP36623_P050) antibody is Catalog # AAP36623 (Previous Catalog # AAPP07862) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GJD2 |
| Uniprot ID |
Q9UKL4 |
| Protein Name |
Gap junction delta-2 protein |
| Sample Type Confirmation |
GJD2 is supported by BioGPS gene expression data to be expressed in Jurkat |
| Protein Accession # |
NP_065711 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_020660 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
GJD2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92% |
| Image 1 | Mouse brain
 | Sample Type: mouse brain
Dilution:dilution 1:2000 |
|
| Image 2 | Western Blot
 | 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. |
|
