GJA4 Antibody - middle region (ARP36603_P050)

• Product Number: ARP36603_P050
• Name: GJA4 Antibody - middle region (ARP36603_P050)
• Protein Size (# AA): 333 amino acids
• Molecular Weight: 37 kDa
• NCBI Gene Id: 2701
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Gap junction protein, alpha 4, 37kDa
• Alias Symbols: CX37
• Peptide Sequence: Synthetic peptide located within the following region: QKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Cepni,I., (2008) Fertil. Steril. 89 (2), 417-420
• Description of Target: GJA4 is a member of the connexin family. The protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction.This gene encodes a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-GJA4 (ARP36603_P050) antibody is Catalog # AAP36603 (Previous Catalog # AAPP07842)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GJA4
• Uniprot ID: P35212
• Protein Name: Gap junction alpha-4 protein
• Sample Type Confirmation:

  GJA4 is strongly supported by BioGPS gene expression data to be expressed in 721_B

• Protein Accession #: NP_002051
• Purification: Affinity Purified
• Nucleotide Accession #: NM_002060
• Tested Species Reactivity: Human
• Gene Symbol: GJA4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 86%; Sheep: 93%
• Image 1: Human Lung Tissue
  
  Rabbit Anti-GJA4 Antibody
  Catalog Number: ARP36603_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue
  Observed Staining: Membrane in alveolar type I cells and macrophages
  Primary Antibody Concentration: 1:100
  Other Working Concentrations: 1/600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec
  
• Image 2: Human 721_B
  
  Host: Rabbit
  Target Name: GJA4
  Sample Type: 721_B
  Antibody Dilution: 1.0ug/ml