ADRB1 antibody - middle region (ARP36551_P050)

• Product Number: ARP36551_P050
• Name: ADRB1 antibody - middle region (ARP36551_P050)
• Protein Size (# AA): 477 amino acids
• Molecular Weight: 51 kDa
• NCBI Gene Id: 153
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Adrenergic, beta-1-, receptor
• Alias Symbols: RHR, B1AR, FNSS2, ADRB1R, BETA1AR
• Peptide Sequence: Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ulucan,C., (er) J. Cardiovasc. Electrophysiol. (2008) In press
• Description of Target: The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in ADRB1 gene have been shown to affect the resting heart rate and can be involved in heart failure.The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in this gene have been shown to affect the resting heart rate and can be involved in heart failure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: GPRASP1; GPRASP2; SNTA1; ARRB2; ARRB1; MAGI2; DLG4; GRB2; ADRA2A; MAGI3; DLGAP2; GOPC; GIPC1; SH3GL2; SH3GL3; DLG1; NOS1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  SPR Affinity Characterization
  
• Blocking Peptide: For anti-ADRB1 (ARP36551_P050) antibody is Catalog # AAP36551 (Previous Catalog # AAPP07702)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ADRB1
• Uniprot ID: P08588
• Protein Name: Beta-1 adrenergic receptor
• Publications:

  Propranolol sensitizes thyroid cancer cells to cytotoxic effect of vemurafenib. Oncol. Rep. 36, 1576-84 (2016). 27432558

  Tsai, W.-C. et al. Testosterone replacement increases aged pulmonary vein and left atrium arrhythmogenesis with enhanced adrenergic activity. Int. J. Cardiol. 176, 110-8 (2014). 25037694

• Protein Accession #: NP_000675
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000684
• Tested Species Reactivity: Human
• Gene Symbol: ADRB1
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Dog: 87%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
• Image 1: Human Brain
  
  WB Suggested Anti-ADRB1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Human brain
• Image 2: Mouse liver, Mouse spleen
  
  Host: Rabbit
  Target: ADRB1
  Positive control (+): Mouse liver (M-LI)
  Negative control (-): Mouse spleen (M-SP)
  Antibody concentration: 1ug/ml
• Image 3: Human Adult Placenta
  
  Host: Rabbit
  Target Name: ADRB1
  Sample Type: Human Adult Placenta
  Antibody Dilution: 1.0ug/ml
• Image 4: Human Fetal Muscle
  
  Host: Rabbit
  Target Name: ADRB1
  Sample Type: Human Fetal Muscle
  Antibody Dilution: 1.0ug/ml
• Image 5: Human Fetal Lung
  
  Host: Rabbit
  Target Name: ADRB1
  Sample Type: Human Fetal Lung
  Antibody Dilution: 1.0ug/ml
• Image 6: Human Fetal Heart
  
  Host: Rabbit
  Target Name: ADRB1
  Sample Type: Human Fetal Heart
  Antibody Dilution: 1.0ug/ml
• Image 7:
  
  Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 0.5, 5, and 50 ug/mL. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for either two or three concentrations were averaged and results and standard deviation are shown.
• Image 8:
  
  25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.