DHX34 Antibody - middle region (ARP36417_P050)

Data Sheet
 
Product Number ARP36417_P050
Product Page www.avivasysbio.com/dhx34-antibody-middle-region-arp36417-p050.html
Name DHX34 Antibody - middle region (ARP36417_P050)
Protein Size (# AA) 1,143 amino acids
Molecular Weight 128kDa
NCBI Gene Id 9704
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name DEAH (Asp-Glu-Ala-His) box polypeptide 34
Description
Alias Symbols HRH1, DDX34
Peptide Sequence Synthetic peptide located within the following region: VPGRLFPITVVYQPQEAEPTTSKSEKLDPRPFLRVLESIDHKYPPEERGD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. It is mapped to the glioma 19q tumor suppressor region and is a tumor suppressor candidate gene.
Protein Interactions UBC; EXOC8; TRMT2A; RPS6KA6; GSK3B; POLA2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DHX34 (ARP36417_P050) antibody
Blocking Peptide For anti-DHX34 (ARP36417_P050) antibody is Catalog # AAP36417 (Previous Catalog # AAPP08473)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human DHX34
Uniprot ID Q14147
Sample Type Confirmation

There is BioGPS gene expression data showing that DHX34 is expressed in HEK293T

Protein Accession # NP_919409
Purification Affinity Purified
Nucleotide Accession # NM_194428
Tested Species Reactivity Human
Gene Symbol DHX34
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 86%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 79%
Image 1
Human 293T
WB Suggested Anti-DHX34 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that DHX34 is expressed in HEK293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com