Product Number |
ARP36417_P050 |
Product Page |
www.avivasysbio.com/dhx34-antibody-middle-region-arp36417-p050.html |
Name |
DHX34 Antibody - middle region (ARP36417_P050) |
Protein Size (# AA) |
1,143 amino acids |
Molecular Weight |
128kDa |
NCBI Gene Id |
9704 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
DEAH (Asp-Glu-Ala-His) box polypeptide 34 |
Description |
|
Alias Symbols |
HRH1, DDX34 |
Peptide Sequence |
Synthetic peptide located within the following region: VPGRLFPITVVYQPQEAEPTTSKSEKLDPRPFLRVLESIDHKYPPEERGD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. It is mapped to the glioma 19q tumor suppressor region and is a tumor suppressor candidate gene. |
Protein Interactions |
UBC; EXOC8; TRMT2A; RPS6KA6; GSK3B; POLA2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-DHX34 (ARP36417_P050) antibody |
Blocking Peptide |
For anti-DHX34 (ARP36417_P050) antibody is Catalog # AAP36417 (Previous Catalog # AAPP08473) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human DHX34 |
Uniprot ID |
Q14147 |
Sample Type Confirmation |
There is BioGPS gene expression data showing that DHX34 is expressed in HEK293T |
Protein Accession # |
NP_919409 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_194428 |
Tested Species Reactivity |
Human |
Gene Symbol |
DHX34 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 86%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 79% |
Image 1 | Human 293T
| WB Suggested Anti-DHX34 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:12500 Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that DHX34 is expressed in HEK293T |
|