DHX9 Antibody - N-terminal region : FITC (ARP36343_P050-FITC)

• Product Number: ARP36343_P050-FITC
• Name: DHX9 Antibody - N-terminal region : FITC (ARP36343_P050-FITC)
• Protein Size (# AA): 1279 amino acids
• Molecular Weight: 141kDa
• Conjugation: FITC: Fluorescein Isothiocyanate
• NCBI Gene Id: 1660
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: DEAH (Asp-Glu-Ala-His) box polypeptide 9
• Alias Symbols: LKP, RHA, DDX9, NDH2, NDHII
• Peptide Sequence: Synthetic peptide located within the following region: GLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Reference: Aratani,S., (2006) Biochem. Biophys. Res. Commun. 340 (1), 125-133
• Description of Target: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX9 is a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression.DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression. It contains 2 copies of a double-stranded RNA-binding domain, a DEXH core domain and an RGG box. The RNA-binding domains and RGG box influence and regulate RNA helicase activity.
• Protein Interactions: UBC; PA2G4; FBXW11; AURKA; SUMO2; SUMO3; MDM2; CEP250; SART3; STAU1; IVNS1ABP; EIF2AK2; LGR4; SUMO1; WWOX; RPA3; RPA2; RPA1; SUZ12; EED; EZH2; RNF2; rev; DDX1; APBB1; ABCF1; FLII; PRPF40A; C14orf166; RTCB; RPL26L1; NELFB; HNRNPA0; IGF2BP3; LRRFIP1; MAP7;
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-DHX9 (ARP36343_P050-FITC) antibody is Catalog # AAP36343 (Previous Catalog # AAPP08650)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DHX9
• Uniprot ID: Q08211
• Protein Name: ATP-dependent RNA helicase A
• Publications:

  Kawai, S. & Amano, A. BRCA1 regulates microRNA biogenesis via the DROSHA microprocessor complex. J. Cell Biol. 197, 201-8 (2012). ICC/IF, IP, Rat, Dog, Mouse, Horse, Rabbit, Bovine, Pig, Human 22492723

• Protein Accession #: NP_001348
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001357
• Gene Symbol: DHX9
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Image 1: