DHX9 Antibody - N-terminal region (ARP36343_P050)

• Product Number: ARP36343_P050
• Name: DHX9 Antibody - N-terminal region (ARP36343_P050)
• Protein Size (# AA): 1279 amino acids
• Molecular Weight: 141kDa
• NCBI Gene Id: 1660
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: DEAH (Asp-Glu-Ala-His) box polypeptide 9
• Alias Symbols: LKP, RHA, DDX9, NDH2, NDHII
• Peptide Sequence: Synthetic peptide located within the following region: GLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Aratani,S., (2006) Biochem. Biophys. Res. Commun. 340 (1), 125-133
• Description of Target: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX9 is a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression.DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression. It contains 2 copies of a double-stranded RNA-binding domain, a DEXH core domain and an RGG box. The RNA-binding domains and RGG box influence and regulate RNA helicase activity.
• Protein Interactions: UBC; PA2G4; FBXW11; AURKA; SUMO2; SUMO3; MDM2; CEP250; SART3; STAU1; IVNS1ABP; EIF2AK2; LGR4; SUMO1; WWOX; RPA3; RPA2; RPA1; SUZ12; EED; EZH2; RNF2; rev; DDX1; APBB1; ABCF1; FLII; PRPF40A; C14orf166; RTCB; RPL26L1; NELFB; HNRNPA0; IGF2BP3; LRRFIP1; MAP7;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-DHX9 (ARP36343_P050) antibody is Catalog # AAP36343 (Previous Catalog # AAPP08650)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DHX9
• Uniprot ID: Q08211
• Protein Name: ATP-dependent RNA helicase A
• Publications:

  Kawai, S. & Amano, A. BRCA1 regulates microRNA biogenesis via the DROSHA microprocessor complex. J. Cell Biol. 197, 201-8 (2012). 22492723

• Protein Accession #: NP_001348
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001357
• Tested Species Reactivity: Human
• Gene Symbol: DHX9
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Application: IHC, WB, IP
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human Pancreas
  
  Human Pancreas
• Image 2: Transfected 293T
  
  WB Suggested Anti-DHX9 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Transfected 293T
• Image 3: HEK293 Whole Cell Lysate
  
  DHX9 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with ARP36343_P050 with 1:200 dilution. Western blot was performed using ARP36343_P050 at 1/1000 dilution.
  Lane 1: Control IP in HEK293 Whole Cell Lysate.
  Lane 2: DHX9 IP with ARP36343_P050 in HEK293 Whole Cell Lysate.
  Lane 3: Input of HEK293 Whole Cell Lysate.