| Product Number |
ARP36141_T100 |
| Product Page |
www.avivasysbio.com/tgif2ly-antibody-middle-region-arp36141-t100.html |
| Name |
TGIF2LY Antibody - middle region (ARP36141_T100) |
| Protein Size (# AA) |
185 amino acids |
| Molecular Weight |
21kDa |
| NCBI Gene Id |
90655 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
TGFB-induced factor homeobox 2-like, Y-linked |
| Alias Symbols |
TGIFLY |
| Peptide Sequence |
Synthetic peptide located within the following region: NWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEASVPAKSGP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Skaletsky,H., (2003) Nature 423 (6942), 825-837 |
| Description of Target |
TGIF2LY is a member of the TALE/TGIF homeobox family of transcription factors. This gene lies within the male specific region of chromosome Y, in a block of sequence that is thought to be the result of a large X-to-Y transposition. The C-terminus of this protein is divergent from that of its chromosome X homolog (TGIF2LX), suggesting that this protein may act as a regulator of TGIF2LX.This gene encodes a member of the TALE/TGIF homeobox family of transcription factors. This gene lies within the male specific region of chromosome Y, in a block of sequence that is thought to be the result of a large X-to-Y transposition. The C-terminus of this protein is divergent from that of its chromosome X homolog (TGIF2LX), suggesting that this protein may act as a regulator of TGIF2LX. |
| Protein Interactions |
MBIP; NAB2; YWHAQ; PCBD2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TGIF2LY (ARP36141_T100) antibody |
| Blocking Peptide |
For anti-TGIF2LY (ARP36141_T100) antibody is Catalog # AAP36141 (Previous Catalog # AAPP08928) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TGIF2LY |
| Uniprot ID |
Q8IUE0 |
| Protein Name |
Homeobox protein TGIF2LY |
| Protein Accession # |
NP_631960 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_139214 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TGIF2LY |
| Predicted Species Reactivity |
Human, Yeast |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Yeast: 90% |
| Image 1 | Human HepG2
 | WB Suggested Anti-TGIF2LY Antibody
Titration: 1.25 ug/ml
Positive Control: HepG2 Whole Cell |
|
|
