| Product Number |
ARP35960_P050 |
| Product Page |
www.avivasysbio.com/mesp1-antibody-c-terminal-region-arp35960-p050.html |
| Name |
MESP1 Antibody - C-terminal region (ARP35960_P050) |
| Protein Size (# AA) |
268 amino acids |
| Molecular Weight |
28kDa |
| NCBI Gene Id |
55897 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Mesoderm posterior 1 homolog (mouse) |
| Alias Symbols |
bHLHc5 |
| Peptide Sequence |
Synthetic peptide located within the following region: GRGLGLVSAVRAGASWGSPPACPGARAAPEPRDPPALFAEAACPEGQAME |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
MESP1 is a transcription factor. MESP1 plays a role in the epithelialization of somitic mesoderm and in the development of cardiac mesoderm. MESP1 defines the rostrocaudal patterning of the somites by participating in distinct Notch pathways. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MESP1 (ARP35960_P050) antibody |
| Blocking Peptide |
For anti-MESP1 (ARP35960_P050) antibody is Catalog # AAP35960 (Previous Catalog # AAPP07218) |
| Uniprot ID |
Q9BRJ9 |
| Protein Name |
Mesoderm posterior protein 1 |
| Protein Accession # |
NP_061140 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_018670 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MESP1 |
| Predicted Species Reactivity |
Human, Cow, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 90%; Horse: 90%; Human: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-MESP1 Antibody
Titration: 1.0 ug/ml
Positive Control: Jurkat Whole Cell |
|
|
